KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406574Help
Entry
100406574         CDS       T03264                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00500  Starch and sucrose metabolism
cjc01100  Metabolic pathways
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04910  Insulin signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
Module
cjc_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100406574 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100406574 (GYS1)
   04152 AMPK signaling pathway
    100406574 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100406574 (GYS1)
   04922 Glucagon signaling pathway
    100406574 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    100406574 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cjc01003]
    100406574 (GYS1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100406574 (GYS1)
Glycosyltransferases [BR:cjc01003]
 Polysaccharide
  Storage polysaccharide
   100406574 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 100406574
NCBI-ProteinID: XP_017822886
Ensembl: ENSCJAG00000000232
UniProt: U3D378
LinkDB All DBs
Position
22
AA seq 737 aa AA seqDB search
MPLHRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRTGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPNEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRSGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTVTSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttacaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaatttgatctggagaacacagtgctcttcgaagtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacaggggatgaatggggcgac
aactactacctggtggggccgtacacggagcagggcgtgaggacccaggtggagctgctg
gaggcccccaccccggccctgaagaggacactggactccatgaacagcaagggctgcaag
gtgtattttgggcgctggctgatcgagggaggccccctagtggtgctcctggacgtgggg
gcctcggcctgggccctggaacgctggaagggagagctctgggatacctgcaacatcggg
gtgccgtggtacgaccgcgaggccaacgacgctgtcctctttggctttctcaccacctgg
ttcctgggtgagttcctggcgcagagtgaggagaagccgcacgtggttgcacacttccat
gagtggttggcaggcattggactctgcctgtgtcgtgcccggcgactgcctgtggcaacc
atcttcaccacccatgccacgctgctggggcgctacctgtgtgctggtgccgtggacttc
tacaacaacctggagaacttcaatgtggacaaggaagcaggtgagaggcagatctatcac
cgctactgtatggaaagggcggcagcccactgtgctcacgtcttcactactgtgtcccag
atcactgccattgaggcacaacacttgctcaagaggaaaccagatattgtgacccccaac
gggctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttgtacttctttatcgccggccgctacgagttctccaacaagggtgctgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaacggcagcgagcag
acagtggttgccttcttcatcatgccggcgcggaccaacaatttcaacgtggaaaccctc
aaaggccaggccgtgcgcaaacagctttgggacacggccaacacggtgaaggaaaagttc
gggaggaagctttacgaatccttgctggttgggagccttccggacatgaacaagatgctg
gataaggaagatttcaccatgatgaagagagccatctttgccacgcagcggcagtccttc
cccccggtgtgcacccacaatatgctggacgactcctcagaccccatcctaaccaccatc
cgccgaactggcctcttcaacagcagtgccgacagggtgaaggtgattttccacccggag
ttcctctcctccacaagccccctgctccctgtggactatgaggagtttgtccgtggctgt
caccttggggtcttcccctcctactatgaaccttggggctacacgccggctgagtgcacg
gttatgggcatccccagtatctccaccaatctctccggctttggctgcttcatggaggaa
cacatcgcagacccctcagcctacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacagagcgcctctctgaccttctggactggaaatac
ctaggccggtactacatgtccgcacgacacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccaacgaggcggatgcgacccaggggtaccgctacccacggccagcc
tcggtgccaccgtcgccctcgctgtcacgacactccagcccgcaccaaagcgaggacgag
gaggatccccggagcgggccgctggaggaagacggcgagcgctacgatgaggacgaggag
gccgccaaggaccggcgcaacatccgtgcaccagagtggccgcgccgcgcctcctgcacc
tcctccaccagcgggagcaagcgtaactctgtggacacggtcacctccagctcgctcagc
acccccagcgagcctctcagccccaccagctccctgggcgaggagcgcaattaa

DBGET integrated database retrieval system