KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406735
Entry
100406735         CDS       T03264                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04713  Circadian entrainment
cjc04720  Long-term potentiation
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04726  Serotonergic synapse
cjc04727  GABAergic synapse
cjc04728  Dopaminergic synapse
cjc04742  Taste transduction
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04924  Renin secretion
cjc04925  Aldosterone synthesis and secretion
cjc04927  Cortisol synthesis and secretion
cjc04929  GnRH secretion
cjc04930  Type II diabetes mellitus
cjc04934  Cushing syndrome
cjc04935  Growth hormone synthesis, secretion and action
cjc05010  Alzheimer disease
cjc05020  Prion disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05031  Amphetamine addiction
cjc05410  Hypertrophic cardiomyopathy
cjc05412  Arrhythmogenic right ventricular cardiomyopathy
cjc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100406735 (CACNA1C)
   04020 Calcium signaling pathway
    100406735 (CACNA1C)
   04024 cAMP signaling pathway
    100406735 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    100406735 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100406735 (CACNA1C)
   04929 GnRH secretion
    100406735 (CACNA1C)
   04912 GnRH signaling pathway
    100406735 (CACNA1C)
   04921 Oxytocin signaling pathway
    100406735 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    100406735 (CACNA1C)
   04924 Renin secretion
    100406735 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    100406735 (CACNA1C)
   04927 Cortisol synthesis and secretion
    100406735 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100406735 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100406735 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100406735 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100406735 (CACNA1C)
   04727 GABAergic synapse
    100406735 (CACNA1C)
   04725 Cholinergic synapse
    100406735 (CACNA1C)
   04728 Dopaminergic synapse
    100406735 (CACNA1C)
   04726 Serotonergic synapse
    100406735 (CACNA1C)
   04720 Long-term potentiation
    100406735 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    100406735 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    100406735 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100406735 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100406735 (CACNA1C)
   05020 Prion disease
    100406735 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    100406735 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    100406735 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100406735 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100406735 (CACNA1C)
   05414 Dilated cardiomyopathy
    100406735 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100406735 (CACNA1C)
   04934 Cushing syndrome
    100406735 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100406735 (CACNA1C)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100406735 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 100406735
NCBI-ProteinID: XP_017831351
Ensembl: ENSCJAG00000000732
LinkDB
Position
9
AA seq 2138 aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCRPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEVVEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNP
ETTGEDDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGE
VDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTG
LFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEEN
SRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQ
VFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNS
TEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRI
WAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNA
TLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYA
TFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELD
KAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDT
ESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRLPRPTGHPSTVSTVEGHGPPLSP
AIRVQEVAWKLSSQRCHSRESQTAVVGQEETSQDETYEVKMNDDTEACSEPSLLSTEMLS
YQDDENRQLTLPEEDKRDIRQSPKRGFLRTASLGRRASFHLECLKRQKDRAGDISQKTVL
PLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPIPTLRLEGAESI
EKLNSSFPSIHCGSWAETTPCGGGSSAARRARPVSLTVPSQAGAPGRQFHGSASSLVEAV
LISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNC
RDAGQDLAGGEEDAGCVLARGRLSEEELQDSRVYVSSL
NT seq 6417 nt   +upstreamnt  +downstreamnt
atggtcaatgagaatacgaggatgtacattccagaggaaaaccaccaaggttccaactat
gggagcccacgccccgcccatgccaacatgaatgccaatgcagcagcggggctggcccct
gagcacatccccactccgggggctgccctgtcctggcaggcagccatcgacgcagcccgg
caggctaagctgatgggcagtgctggcaatgcgaccatctccacggtcagctccacacag
cggaagcggcagcaatatgggaaacccaagaagcagggcagcaccacggccacacgcccg
ccccgagccctgctctgcctgaccctgaagaaccccatccgaagggcctgcatcagcatt
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattccctttccagaagatgattccaacgccaccaattccaacctggaa
cgagtggaatatctctttctcataatttttacggtggaagcatttttaaaagtaatcgcc
tatggactcctctttcaccccaatgcctacctccgcaacggctggaatctactagatttt
ataatcgtggttgtggggctttttagtgcaattttagaacaagccaccaaagcagatggg
gcaaacgctcttggagggaaaggggccggatttgatgtgaaggcgctgagggccttccgc
gtgctgcgtcccctgcggctggtgtctggagtcccaagtctccaggtggttctgaattct
atcatcaaggccatggtccccctgctgcacatcgccctgcttgtgctgtttgtcatcatc
atctacgccatcatcggcctggagctcttcatggggaagatgcacaagacctgctacaac
caggagggcatagcagatgttccagcagaagatgacccttccccttgtgcgctggaaaca
ggacatgggcggcagtgccagaatggcacggtatgcaggcccggctgggatgggcccaag
cacggcatcaccaactttgacaactttgccttcgccatgctcacagtgttccagtgcatc
accatggaaggctggacggacgtgctgtactggatgcaggacgctatgggctatgagtta
ccctgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctggtt
ctcggtgtgttgagcggagagttttccaaagagagggagaaggccaaggcccggggagat
ttccagaagctgcgggagaagcaacaactggaagaggatctcaaaggctacctggactgg
atcactcaggccgaagacattgacccagagaacgaggacgaaggcatggatgaggagaag
ccccgaaacatgagcatgcccaccagtgagaccgagtctgtcaacaccgaaaacgtggct
ggaggtgacatcgagggagaaaactgtggggccaggctggcccaccggatctccaagtca
aagttcagccgctactggcgccgatggaatcggttctgcaggagaaagtgccgcgccgca
gtcaagtctaatgttttctactggctggtgattttcctggtgttcctcaacacgctcacc
attgcctctgagcactacaaccagccccactggctcacagaagtccaagacacagccaac
aaggccctgctggccctgttcacggcagagatgctcctgaagatgtacagcctgggcctg
caagcctactttgtgtctctcttcaaccgctttgactgcttcgtcgtgtgtggcggcatc
ctggagaccatcctggtggagaccaagatcatgtccccactgggcatctccgtgctcaga
tgcgtccggctgctgaggatattcaagatcacaaggtactggaactccttgagcaacctg
gtggcatccttgctgaactctgtgcgctccatcgcctccctgctccttctcctcttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggaggaaagttcaactttgat
gagatgcagacccggaggagcacgtttgataacttcccccagtccctcctcactgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aactatatcctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgag
agcctcacatctgcccaaaaggaggaggaagaggagaaagagagaaagaagctggccagg
actgccagcccagagaagaaacaagaggtggtggagaagccagcagtggaggaatccaag
gaggagaagattgagctgaaatccatcacggctgatggggagtctccacccaccaccaag
atcaacatggatgacctccagcccaatgaaaatgaggataagagcccctaccccaaccca
gaaactacaggagaagatgatgaggaagagccagagatgcctgtcggccctcgcccacga
ccactctctgagcttcaccttaaggaaaaggcggtgcccatgccagaagccagcgcattt
ttcatcttcagctctaacaacaggtttcgcctccagtgccaccgcattgtcaatgacacg
atcttcaccaacctgatcctcttcttcattctgctcagcagcatttccctggctgctgag
gacccagtccagcacacctccttcaggaaccacatcctaggcaatgcagactatgtcttc
actagtatctttacattagaaattatccttaagatgactgcttatggggctttcctgcac
aagggctctttctgccggaactacttcaacatcctagacctgctggtggtcagcgtgtcc
ctcatctcctttggcatccagtccagtgcaatcaatgttgtgaagatcttgcgagtcctg
cgagtactcaggcccctgagggccatcaacagggccaaggggctaaagcatgtggttcag
tgcgtgtttgtcgccatccggaccatcgggaacatcgtcattgtcaccaccctgctgcag
ttcatgttcgcctgcatcggggtccagctcttcaagggaaagctgtacacctgttcagac
agttccaagcagacagaggcagaatgcaagggcaactacatcacgtacaaagacggggag
gttgaccaccccatcatccagccccgcagctgggagaacagcaagtttgactttgacaac
gttctggcggccatgatggcgctcttcacagtctccacctttgaagggtggccagagctg
ctgtaccgctccatcgactcccacacggaagacaagggccccatctacaactaccgcgtg
gaaatctccatcttcttcatcatctacatcatcatcattgccttcttcatgatgaacatc
ttcgtgggtttcgtcatcgtcaccttccaggagcagggggagcaggagtacaagaactgt
gagctggacaagaaccagcgacagtgtgtggaatacgccctcaaggcccggcccctacga
aggtacatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaactccacctac
ttcgagtacctgatgttcgtcctcatcctgctcaacaccatctgcctggccatgcagcac
tatggccagagctgcctgttcaaaatcgccatgaacatcctcaacatgctcttcactggc
ctcttcactgtggagatgatcctgaagctcattgccttcaaacccaagcactatttctgt
gatgcatggaatacatttgacgccttgattgttgtgggtagcattgttgatatagcaatc
accgaggtaaacccagctgaacatacccaatgctctccctctatgaacgcagaggagaac
tcccgcatctccatcaccttcttccgcctgttccgggtcatgcgcctggtgaagctgctg
agccgcggggagggcatcaggacgctgctgtggaccttcatcaagtccttccaggccctg
ccctatgtggccctcctgatcgtgatgctgttcttcatctacgcggtgatcgggatgcag
gtgtttgggaaaattgccctgaatgataccacagagatcaaccggaacaacaattttcag
accttcccccaagctgtgctgctcctcttcaggtgtgccactggggaggcctggcaggac
atcatgctggcctgcatgccaggcaagaagtgtgccccagagtctgagcccagcaacagc
acggagggtgaaacaccctgtggcagcagctttgccgtcttctacttcatcagcttctac
atgctctgtgccttcctgatcatcaacctctttgtagctgtcatcatggacaactttgac
tacctgacaagggactggtccatccttggtccccaccacctggatgagtttaaaagaatt
tgggcagagtacgaccctgaagccaagggtcgtatcaaacacctggacgtggtgaccctt
ctccggcggattcagcccccactgggttttgggaagctgtgccctcaccgtgtggcttgc
aaacgcctggtctccatgaacatgcctctgaacagcgacgggacagtcatgttcaatgcc
accctgtttgccctggtcaggacggccctgaggatcaaaacagaagggaacctagaacaa
gccaacgaggagctgcgggccatcatcaagaagatctggaagcggaccagcatgaagctg
ctggaccaagtggtgccccctgcaggtgatgatgaggtcaccgttggcaagttctatgcc
acgttcctgatccaggagtacttccggaagttcaagaagcgtaaagagcagggccttgtg
ggcaagccctcccagaggaacgcgctgtctctgcaggctggcttgcgcacgctgcatgac
atcggacctgagatccgacgggccatctctggagatctcactgctgaggaggagttggac
aaggccatgaaggaggctgtgtccgctgcctctgaagatgacatcttcaggagggccggt
ggcctcttcggcaaccacgtcagctactaccaaagtgacggccggagcgccttcccccag
accttcaccactcagcgcccgctgcacatcaacaaggcaggcagcagccagggtgacaca
gagtcgccttcccacgagaagctggtggattccaccttcactcccagcagctactcgtcc
accggctccaatgccaacatcaacaatgccaacaacaccgccctgggccgcctcccccgc
cccactggccaccccagcacggtcagcactgtggagggccatgggccccccttgtcccct
gccatccgggtgcaggaggtggcctggaagctcagctcccagaggtgccactcccgggag
agccagacagccgtggtgggtcaggaggagacatctcaggatgagacttacgaagtgaag
atgaacgatgacacggaggcctgcagtgagcccagcctgctctccacagagatgctctcc
taccaggatgacgaaaatcggcaactgacactcccagaggaggacaagagggacatcagg
caatccccaaagaggggtttcctccgcaccgcctcactaggtcgaagggcctccttccac
ctggaatgtctgaagcgacagaaggaccgagcgggagacatctctcagaagacagtcctg
cccttgcatctggttcatcatcaggcactggcagtggcaggcctgagccccctcctccag
agaagccattcccccgcctcattccccaggccttttgccacccccccggccacacctggc
agccgaggctggcccccacagcccatccccaccctgcggctagagggggctgagtccatc
gagaaactcaacagcagcttcccgtccatccactgcggctcctgggctgagaccaccccc
tgtggcgggggcagcagcgccgcccggagagctcggcccgtctccctcacggtgcccagc
caggctggggccccagggaggcagttccatggcagtgccagcagcctggtggaagcggtc
ttgatttcagaaggactggggcagtttgctcaagatcccaagttcatcgaggtcaccacc
caggagctggccgacgcctgcgacatgaccatagaggagatggagagcgcagccgacaac
atcctcagcgggggcgccccacagagccccaatggcgccctcttaccctttgtgaactgc
agggacgcggggcaggacctagccgggggcgaagaggacgcgggctgtgtgctcgcgcgg
gggcggctgagtgaggaggagctccaggacagcagggtctacgtcagcagcctgtag

DBGET integrated database retrieval system