KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406747Help
Entry
100406747         CDS       T03264                                 

Gene name
TCL1B
Definition
(RefSeq) T-cell leukemia/lymphoma 1B
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100406747 (TCL1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCL1_MTCP1
Motif
Other DBs
NCBI-GeneID: 100406747
NCBI-ProteinID: XP_017832969
LinkDB All DBs
Position
10
AA seq 140 aa AA seqDB search
MASEASLHPGAPPTRLWIQSPGIYEDESGRNWVTVVVRFSPSRREWARLSSSQGGASQDS
ASQSSTYEPSITVHLWQMAVHRRDPLSPNQMPFSRLPTVWQLYPGNKYRASDSSFWEIVN
HGQIDSFEELVLTYETERNH
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgaagcttctctgcatccaggggcaccccccacccgtctgtggatccaaagc
cctggcatctacgaggacgagtcggggaggaactgggtgactgtagttgtgcggttcagt
ccatcgcgaagagaatgggccaggctctcaagctcccagggcggcgcctcccaggacagc
gcctcccagagcagcacatatgaacccagcatcacagtgcacttgtggcagatggcagtg
caccgccgggatccactgtcccccaaccagatgcccttctcccggctgcccaccgtgtgg
cagctctaccctgggaataagtaccgagcatcggattccagtttctgggaaatagtgaac
catggccagatcgactccttcgaggagctggtcctaacatatgagacagagaggaatcac
tga

DBGET integrated database retrieval system