KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406751
Entry
100406751         CDS       T03264                                 

Gene name
ILK
Definition
(RefSeq) integrin linked kinase
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03320  PPAR signaling pathway
cjc04360  Axon guidance
cjc04510  Focal adhesion
cjc05100  Bacterial invasion of epithelial cells
cjc05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100406751 (ILK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100406751 (ILK)
  09158 Development and regeneration
   04360 Axon guidance
    100406751 (ILK)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    100406751 (ILK)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100406751 (ILK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100406751 (ILK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100406751 (ILK)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100406751 (ILK)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: TKL group
  MLK family
   100406751 (ILK)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100406751 (ILK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Ank_5 Pkinase Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 100406751
NCBI-ProteinID: XP_009005842
Ensembl: ENSCJAG00000013968
UniProt: F7DKL4
LinkDB
Position
11
AA seq 483 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRGPSPHPLACVLLSLPTCLLPLYHSSGCFSSL
ERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWK
GRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLIT
HWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDE
DMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTRE
VPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKM
QDK
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcagtcgccgttcgcctgtggctg
gacaacacggagaacgacctcaaccagggggacgatcatggcttctcccccttgcactgg
gcctgccgagagggccgctctgctgtggttgagatgctgatcatgcggggggcacggatc
aatgtaatgaaccgtggggatgacacccccctgcatctggcagccagtcatggacaccgt
gatattgtacagaagctattgcagtacaaggcagacatcaatgcagtgaacgaacatggg
aacgtgcccctgcactatgcctgtttttggggccaagaccaagtggcagaggacctggtg
gcaaatggggcccttgtcagcatctgtaataagtatggagaaatgcctgtggacaaagcc
aaggcacccctgagagagcttctccgaggtccatctccccacccgctagcttgtgtcctc
ttgtcccttcccacctgtcttcttcctctgtaccacagctcaggttgtttttcttcccta
gagcgggcagagaagatgggccagaatctcaaccgtattccatacaaggatacattctgg
aaggggaccacccgcactcggccccgaaatggaaccctgaacaaacactctggcattgac
ttcaaacagctgaacttcctgacgaagctcaatgagaatcactctggagagctatggaag
ggccgctggcagggcaatgacattgtcgtgaaggtgctgaaggttcgagactggagtaca
aggaagagcagggacttcaatgaagagtgtcccaggctcaggattttctcgcatccaaat
gtgctcccagtgctaggtgcctgccagtctccacctgctcctcatcctaccctcatcaca
cactggatgccatatggatccctctacaatgtactacatgaaggcaccaattttgttgtg
gaccagagccaggctgtgaagtttgctttggacatggcaaggggcatggccttcctacac
acactagaacccctcatcccacgacatgcactgaatagccgtagtgtaatgattgatgag
gacatgactgcccgaattagtatggctgatgtcaagttctctttccaatgtcctgggcgc
atgtatgcacctgcctgggtagcccctgaagctctgcagaagaagcctgaagacacaaac
agacgctcagcagacatgtggagttttgcagtgcttctgtgggaactggtgacacgggag
gtaccctttgctgatctctccaatatggagattggaatgaaggtggcattggaaggcctt
cggcctaccatcccaccaggtatttcccctcatgtgtgtaagctcatgaagatctgcatg
aatgaagaccctgcaaagcgacccaaatttgatatgattgtgcctatcctggagaagatg
caggacaagtag

DBGET integrated database retrieval system