KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406787
Entry
100406787         CDS       T03264                                 

Gene name
MLH1
Definition
(RefSeq) mutL homolog 1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc03430  Mismatch repair
cjc03460  Fanconi anemia pathway
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05213  Endometrial cancer
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100406787 (MLH1)
   03460 Fanconi anemia pathway
    100406787 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406787 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100406787 (MLH1)
   05226 Gastric cancer
    100406787 (MLH1)
   05213 Endometrial cancer
    100406787 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100406787 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100406787 (MLH1)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100406787 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 100406787
NCBI-ProteinID: XP_002759776
Ensembl: ENSCJAG00000012414
LinkDB
Position
17
AA seq 758 aa
MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPSASTVDNIRSIFGNAVSRELIEIGCEDKTLAF
RMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMV
KSTTSLTSSSTSGSGDKLYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVPEDKTDIS
SGGARQQDEEMLELPAPAEMAAKNQSLEGDTTKATSEMSEKRGPTSRPGNPRKRHREDSD
VDMVEDDSRKDMTAACTPRRRIINLTSVLSLQEEINERGHEILREMLHDHSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGSLIGLPLLIDNYVPPLEGLPIFIL
RLATEVNWDEEKECFKSLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEH
IVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcgttcgtggctggggttattcggcggctggacgagacggtggtgaaccgcatcgcg
gcgggggaagttatccagcggccggctaatgctattaaagagatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggttgttaaagagggaggcctgaagttgattcag
atccaggacaatggcactgggatcaggaaagaagatctggatattgtatgtgagaggttc
actacgagtaaactacagtcctttgaggatttagccagtatttccacctatggctttcga
ggtgaggctttggccagcataagccatgtggctcatgttactattacaacaaaaacagct
gatggaaagtgtgcatacagagcaagttactcagatggaaaactgaaagctcctcctaaa
ccatgtgctggcaatcaagggacccagatcacagtggaggaccttttttacaacatagcc
acgaggagaaaagctttaaaaaatccaagtgaagaatatgggaagattttggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttctcagttaagaaacaaggagagaca
gtagctgatgttaggacactacccagtgcctcaaccgtggacaatattcgctccatcttt
ggaaatgctgtcagtcgagaactgatagaaattggatgtgaggataaaaccctagccttc
agaatgaatggttacatttccaatgcaaactactcggtgaagaagtgcatcttcttactc
tttatcaaccatcgtctggtagaatcaacttccttgagaaaagctatagaaacggtgtat
gcagcctatttgcccaaaaacacacacccattcctatacctcagtttagaaatcagtccc
cagaatgtggatgttaatgtgcatcccacaaagcacgaagttcacttcctgcacgaggag
agcatcctggagcgggtgcagcagcacatcgagagcaagctcttgggctccaattcctcc
aggatgtacttcacccagactttgctgccaggactcgctggcccctctggggagatggtt
aaatccacaacaagtctgacctcctcttctacttctggaagtggtgataagctctatgcc
caccagatggttcgtacagattcccgagaacagaagcttgatgcatttctgcagcctctg
agcaaaccactgtccagtcagccccaggccattgtcccagaggataagacagatatttct
agtggcggggctaggcagcaagatgaggagatgcttgaactcccagcccctgctgaaatg
gctgccaaaaatcagagcctggagggggatacaacaaaggcgacttcagaaatgtcggag
aagagagggcctacttccaggccaggcaatcccagaaagagacatcgggaagattctgat
gtggatatggtggaagatgattcccgaaaggacatgactgcagcctgtaccccccggaga
aggatcattaacctcaccagtgttttgagtctccaggaagaaattaatgagcgaggacat
gagattctccgcgagatgctgcatgaccattccttcgtgggctgtgtgaatcctcagtgg
gccttggcacagcatcagaccaagctataccttctcaacaccaccaagcttagtgaagaa
ctgttctaccagatactcatttatgattttgccaattttggtgtcctgaggttatcggag
ccagcaccgctctttgacctcgccatgcttgctttagatagtccagagagtggctggaca
gaggaagatggtcctaaagaaggacttgctgaatacattgttgagtttctgaagaagaag
gctgagatgcttgcagactatttctctttggaaattgatgaggaagggagcctgattgga
ttaccccttctgattgacaactatgtgccccctttggagggactgcctatcttcattctt
cgactagctactgaggtgaattgggacgaagaaaaggaatgtttcaaaagcctcagtaaa
gaatgtgctatgttctactccatccggaagcagtacatatctgaggagtcgaccctctca
ggccagcagagtgaagtgcctggctccattccaaactcctggaagtggactgtggaacac
attgtctataaagccttgcgttcacacattctgcctcccaaacatttcacagaagatggt
aatatcctgcagcttgctaacctgcctgatctatacaaagtctttgagaggtgctaa

DBGET integrated database retrieval system