KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407171Help
Entry
100407171         CDS       T03264                                 

Gene name
ZNF358
Definition
(RefSeq) zinc finger protein 358
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-Di19 zf-C2H2_6 zinc_ribbon_15 Zn-ribbon_8 zf_UBZ GAGA Zn_ribbon_SprT FYVE Endonuclease_7
Motif
Other DBs
NCBI-GeneID: 100407171
NCBI-ProteinID: XP_017823482
LinkDB All DBs
Position
22
AA seq 554 aa AA seqDB search
MRRSVLVRNPGHKGLRPVYEEVDSDSEDLDPNPEDLDPVSEDPEPDPEDLNTVSENVDPN
YEDLEPISEDLDPDAEALGSEPQDPDPMSSSFDLDPDVIGPVPLVLDPNSDTLSPGDPNV
DPISSDLTDTPQVLATSPAVLPAPASPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYR
CPTAGSPFRPRATLTQHRGIHTGARPYQCGGLPGRPSGWXXXAAEHRSSHSGEKPHHCPV
CGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKA
FGQSSALLQHQRTHTAERPYRCPHCGKAFGQSSNLQHHLRIHTGERPYACPHCSKAFGQS
SALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKRVHEGAAAAAAAAAAGLGLAPGLSP
ASMMRPGQVSLRGPDAVSVLGSGLGLSPGTSSGRSPDPGSGPGTLPDPSSKPLPGSRSTP
SPTPVETSEPKPGQDAGPDLVPSPDPDPVPSPDPDPVSHRDPCSPSGGTVSPALPTGESP
EGIQEQGALLGPDG
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgctcagtcctggtcaggaaccccggccacaaaggcctgagaccggtttatgaa
gaggtcgactctgactctgaggacctggaccctaatcctgaggatctggacccggtttct
gaagacccagagcctgatccagaagacctcaacactgtctcggaaaacgtggaccccaac
tatgaggatctggagcccatctcggaggatctggaccccgacgccgaagctctgggctcg
gaaccccaagatcccgaccccatgtcttcgagtttcgacctcgatccagatgtgattggc
ccggttcccctggttctcgatcctaacagcgacaccctcagccccggcgatccaaacgtg
gaccccatctcctctgacctcactgacaccccccaggtcttggccaccagccccgcggtg
ctccccgcccccgccagccctccccgacccttctcctgcccggattgcgggcgagccttc
cgccgcagctcggggctgagccagcatcgccgcacccacagcggcgagaagccgtaccgc
tgcccgactgcgggaagtcctttcaggccacgtgccaccctgacgcagcatcgtggcatc
cacaccggggcgcgaccgtaccagtgtggcggcctgccgggaaggccttccggctggnnn
nnnnacgctgctgaacatcgcagcagccacagcggggagaagccgcaccactgccccgtg
tgcggcaaggccttcgggcatggctcgctcctggcgcagcacctgcgcacacacggcggc
ccgcggccccacaagtgtccggtgtgcgccaagggcttcggccagggctcggcgctgctg
aaacacctgcgcacacacacaggcgagcggccctacccgtgcccgcagtgcggcaaggcc
ttcgggcagagctcggcgctactgcagcaccagcgcacgcacacagccgagcgcccctat
cgctgtccgcactgcggcaaggccttcgggcagagctccaacttgcaacaccacctgcgc
atccacacgggtgagaggccctacgcctgcccgcactgctctaaggccttcgggcagagc
tcagcgctgctccagcacctgcacgtgcattcgggtgagcgtccctatcgctgtcagctc
tgcgggaaggccttcggccaggcctccagcctcaccaagcacaaacgggtgcatgagggc
gcggccgctgcagccgcagcagctgcggcaggcctgggcctcgcgcctggcctcagccct
gcatccatgatgaggccggggcaggtctccctccggggtcctgatgctgtttctgtgctt
ggctctggcttgggcctcagccctggcaccagctctggccgcagccctgaccccggctct
gggccgggcactctgccggatcccagctccaagcccctcccaggctccagatccaccccc
agccctactcctgtggaaacgtctgaacccaagcctgggcaggatgctggtcctgacctt
gtgcccagcccagaccctgatcctgtgcccagccctgaccccgaccctgtgtcccaccgt
gacccctgctctccctctggtggcactgtcagcccagccctccctaccggcgagagtcca
gaggggatacaggagcaaggggcactgctggggcctgatggctga

DBGET integrated database retrieval system