KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407559Help
Entry
100407559         CDS       T03264                                 

Gene name
RBFOX3
Definition
(RefSeq) RNA binding protein, fox-1 homolog 3
  KO
K14946  RNA binding protein fox-1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    100407559 (RBFOX3)
Spliceosome [BR:cjc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    100407559 (RBFOX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fox-1_C RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 100407559
NCBI-ProteinID: XP_008996104
Ensembl: ENSCJAG00000009563
LinkDB All DBs
Position
5
AA seq 373 aa AA seqDB search
MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPPEHGMTLYTPAQTHPEQPGS
EASTQPIAGTQTVPQTDEAAQTDSQPLQPSDPAEKRQPKRLHVSNIPFRFRDPDLRQMFG
QFGRILDVEIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTN
KKTGNPYTNGWKLNPVVGAVYGPEFYAVTGFPYPTTGTAVAYRGAHLRGRGRAVYNTFRA
APPPPPIPTYGAALEQTLVKMPVPWAGLAPCPLPPQQTPEPAYPTSPAFPPLSCPFASRV
VYQDGFYGAEIYGGYAAYRYAQPAAAAAAYSDSYGRVYAAADPYHHTIGPAATYSIGTMA
SLCRGGYSRFTPY
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcccagccctacccccccgcccagtacccccctccaccacagaacggcatccctgcc
gagtatgcccctcccccaccgcaccccacgcaggactactccggccagaccccagtcccc
ccagagcatggcatgaccctgtacacaccagcacagacccaccctgagcaaccaggctcc
gaggccagcacacagcccatcgccgggacccagacagtgccgcagacagatgaggcggca
cagacggacagccagccgctccagccctccgaccctgcagagaagcggcagcccaagcgg
ctacacgtctccaacatccccttccggttcagggaccccgacttgcggcaaatgttcggg
caattcggaagaatcttagacgtggagatcatctttaacgagcggggctccaagggtttt
gggtttgtaacttttgaaactagctcagatgctgaccgagcccgggagaagctgaatggg
acgatcgtagagggacggaaaattgaggtcaataatgccacggcccgagttatgaccaat
aagaagacggggaacccctacaccaatggctggaagctaaatccagtggtcggcgccgtc
tatgggcctgaattctatgcagtgacggggttcccctaccccaccaccggcacagccgtt
gcctaccggggcgcacatcttcggggccggggccgggccgtatataatacgtttcgggct
gcgccgcccccgccccccatccccacttacggagcggcactggagcaaacgcttgttaaa
atgccagtcccgtgggcggggctggcaccgtgccccctccctcctcagcagacaccggag
ccggcctaccccacctctccagcgttcccaccactttcttgtccgtttgcttccagggtc
gtgtatcaggatggattttatggtgctgagatttatggaggctatgcagcctacagatac
gctcagcccgctgcagcagcagcagcctacagcgacagttacggcagagtctatgcagct
gctgacccgtaccatcacaccattgggcccgcggcgacctacagcattggaaccatggct
agcctctgccgaggagggtacagccgcttcaccccctactag

DBGET integrated database retrieval system