KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407639Help
Entry
100407639         CDS       T03264                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00590  Arachidonic acid metabolism
cjc01100  Metabolic pathways
cjc04064  NF-kappa B signaling pathway
cjc04370  VEGF signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc04723  Retrograde endocannabinoid signaling
cjc04726  Serotonergic synapse
cjc04913  Ovarian steroidogenesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc05140  Leishmaniasis
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05200  Pathways in cancer
cjc05204  Chemical carcinogenesis
cjc05206  MicroRNAs in cancer
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100407639 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100407639 (PTGS2)
   04064 NF-kappa B signaling pathway
    100407639 (PTGS2)
   04668 TNF signaling pathway
    100407639 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100407639 (PTGS2)
   04657 IL-17 signaling pathway
    100407639 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100407639 (PTGS2)
   04913 Ovarian steroidogenesis
    100407639 (PTGS2)
   04921 Oxytocin signaling pathway
    100407639 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    100407639 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100407639 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100407639 (PTGS2)
   05206 MicroRNAs in cancer
    100407639 (PTGS2)
   05204 Chemical carcinogenesis
    100407639 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    100407639 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    100407639 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100407639 (PTGS2)
   05165 Human papillomavirus infection
    100407639 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    100407639 (PTGS2)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100407639 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 100407639
NCBI-ProteinID: XP_002760344
Ensembl: ENSCJAG00000006064
UniProt: U3DE75
LinkDB All DBs
Position
18
AA seq 604 aa AA seqDB search
MLARALLLCAVLALSRAANPCCSYPCQNQGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNFVNNIPFLRNAIMSYVLTSRAHLIESPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSSEIVEKFLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQNYNYQQFIYNNSMLLEHGVTQFVESFTKQIAGRV
AGGRNVPSAVKKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMAAELKAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFRIINTASIQSLICNNVKGCPFTSFSVPDPELTKTVTINASSSRSRLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcggtcctggcgctcagccgtgcagcaaaccct
tgctgttcctacccatgtcaaaaccaaggtgtatgtatgagcgtgggatttgaccagtat
aagtgtgattgtacccggacaggattctatggtgaaaactgctcaacaccggaatttctg
acaagaataaaattatttctgaaacccactccaaacacagtacactacatacttacccac
ttcaagggattttggaactttgtcaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagagcacatttgattgagagtccaccaacctacaatgctgactat
ggctacaaaagctgggaagccttctctaacctctcctattatactagagcccttcctcca
gtacctgatgactgcccgactcccctgggtgtgaaaggtaagaagcagcttcctgattca
agtgagattgtggaaaaatttcttctaagaagaaagttcatccctgatccccagggctca
aatatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaaaggcctgggccatggggtggacttaaatcatatttat
ggtgaaactctggacagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagttcctgagcatctgcggtttgcggtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgagggagcacaacagagtatgcgat
gtgcttaaacaggagcatccggaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagaccattaagattgtgattgaagactatgtacagcacttgagtggc
tatcacttcaaacttaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgagtttaatacgctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaactacaactatcaacagtttatctacaacaactctatgtta
ctggaacatggagttacccagtttgttgaatcattcaccaagcaaattgctggcagggtt
gctggtggtaggaatgttccatctgcagtaaaaaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagagaaggaaatggctgcagagttgaaagcactc
tatggtgacatcgatgctatggagctgtatcctgcccttctggtagaaaagcctcgtccg
gatgccatcttcggtgagacaatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatgtcatatgttctcccgcttactggaagccaagcacttttggtggagaagtg
ggtttcagaatcatcaacacggcctcaattcagtctctcatctgcaataacgtgaaaggc
tgtccctttacttcattcagtgttccagatccagagctcaccaaaacagtcaccattaat
gccagttcttcccgctccagactagatgatatcaatccaacagtactgctaaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system