KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407677
Entry
100407677         CDS       T03264                                 

Gene name
KIF7
Definition
(RefSeq) kinesin family member 7
  KO
K18806  kinesin family member 7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04340  Hedgehog signaling pathway
cjc05200  Pathways in cancer
cjc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100407677 (KIF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407677 (KIF7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100407677 (KIF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100407677 (KIF7)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100407677 (KIF7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 100407677
NCBI-ProteinID: XP_017828789
Ensembl: ENSCJAG00000012723
LinkDB
Position
6
AA seq 1347 aa
MGLEAQRLPAAEEVPVRVALRVRPLLPKELLYGHQSCLQVEPRLGRITLGRDRHFGFHVV
LAEDAGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLLEDEQGIV
PRAMAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDERGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHLNRLSSRSHTVFTVTLEQRGRTPSRLPRPAA
GQLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSSLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSTDFDETLNTLNYASRAQNIRNRATVNWRPE
AERPSEDAASGARGPPRHRSETRIIHRGRHAQGPAAAGAAASSAAAAKRLGAECARYRAC
TDAAYSLLRELHAQPGLPGAAARKVRDWLCAVEGERSNMSSASGPDSGIDSASVEDQVAQ
EAGGRKEDEGVPQLLTLQNQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMVELR
LRLELVRPGWGSPGLLPGLPSGSFLPRPHTAPLGGAHGHMLGMVPPACLSGDEVGSEQRG
EQVTDGREAGAELLADVNRLGSGSSAASEEEDEKEEPPRRTLHLRRNGISNCIQRAGAQP
GSPSDRRGPELCLEELEAAIPGSRAVGGSKARVQARQVPSATASEWRLAQAQQKIRELAI
NIRMKEELIGELVCTGKAAQALNRQHSQRIRELEQEAEQVRAELSEGQRQLRELEGQEPQ
DASERSRLQEFRRRVRCAQSQVQVLKEKKQATERLVSLSAQSEKRLEELERNVQLMRQQQ
GQLQRRLREETEQKRRLEAEMSKRQHRVKELELKHEQQQKILKIKTEEIAAFQRKRRSGS
NGSVVSLEQQQKIEGPKKWLDQEMEKVLQQRRALEELGEELHKREAILAKKEALMQEKTG
LESKRLRSSQALNEDIVRVSSRLEHLEKELSEKSGQLRQGSTQSQQQIRGEIDSLRQEKD
SLLKQRLEIDSKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASAS
LLSQCEMNLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRLV
YWLEVALERQRLEMDRQLTLQQKEHEQNLQLLLQQSRDHLGEGLADSKRQYEARIQALEK
ELGRYMWINQELKQKLGGVNTAGHSRGGEKKSLGSEGRQAPGNEELHPAPELLRLSPLTE
GAPRTREETRDLIHAPLPLTXKRSSLGGEEQGSSEELRQREAAEPLLGRVMPMGEAXLPW
NFGPSSKPWRELRRASPGMIDVRKNPL
NT seq 4044 nt   +upstreamnt  +downstreamnt
atggggctggaagcccagaggctgccagctgctgaagaggtcccggtgcgggttgccctg
cgagttcgacccctgcttcccaaggagctgctgtacgggcatcagagctgcctgcaggtg
gagccaaggcttggccgcatcaccctgggccgggaccgacacttcggcttccacgtggtg
ctggccgaggatgccgggcaggaggctgtgtaccaggcgtgtgtccagcccctcctcgag
gccttctttgagggcttcaatgccaccgtctttgcctatggtcagacgggctctgggaag
acgtacacgatgggggaagccagtgtggcctccctcctcgaggatgagcagggcattgtt
ccgagggccatggccgaggccttcaagctcatcgatgagaacgacctgcttgactgtctg
gtgcatgtgtcctacctggaagtgtacaaggaggagttccgagacctgcttgaggtgggc
accgccagccgtgacatccagctccgggaagatgagcgtgggaatgttgtgctgtgtggg
gtgaaggaggttgacgtggagggcctggatgaggtgctgagcctcctggagatgggcaac
gcggcgcggcacacgggggccacgcacctcaaccgcctgtccagccgctcgcacaccgtg
ttcaccgtgactctggagcagcgagggcgcacccccagccgcctgccccgccccgcggcc
ggccagctgcttgtctccaagttccattttgtggatctggcgggctcggagagggtgctc
aagacgggcagcaccggcgagcgcctcaaggagagcatccagatcaacagcagcctcctg
gcgctgggcaacgtcatcagcgccctaggggacccccagcgccggggtagccacatcccc
taccgcgactccaagatcacccggatcctcaaggactccctgggcgggaacgccaagact
gtgatgatcgcctgcgtcagcccttcctccaccgacttcgacgagaccctcaacaccctc
aactacgccagccgcgcgcagaacatccgtaaccgcgccacggtcaactggcggcccgag
gccgagcggccgtccgaggatgcggctagtggtgcgcgggggccgccgcggcaccgctcg
gagacccgcatcatccaccgcggccggcatgcccagggccccgccgccgccggcgctgcc
gcctcctccgccgcggcagccaagcgcctgggcgccgagtgcgcgcgctaccgggcctgc
accgacgccgcctacagcctcctgcgcgagctgcacgcccagcccgggctgccaggtgct
gcggcacgcaaggtgcgcgactggctgtgcgcggtggagggcgagcgcagcaacatgagc
tccgcctccgggcccgacagcggcatcgacagcgcttccgtcgaggaccaggtggcgcag
gaggccggcgggcgaaaggaggatgagggggtgccgcagctgctgaccctgcagaaccag
gtggcgcggctggaggaggagaaccgagactttctggctgccctggaggacgccatggag
cagtacaagctgcagagcgaccggctgcgtgagcagcaggaggagatggtggagctgagg
ctgcggttagagctggtgcggcctggctgggggtcccccgggctgctgccgggcctgcct
tctgggtcctttctgcctcggcctcatacagcccccctggggggtgcccacggccatatg
ctgggcatggtgccccctgcctgcctcagtggagatgaagttggctctgagcagagggga
gagcaggtgacagatggcagggaggctggagctgagttgctggctgatgtgaacaggctg
ggaagtggctcttcagctgcatcagaggaggaagatgagaaggaggagccgcccaggagg
accttacacctgcgcagaaatgggatcagcaactgcatccagagggcgggggctcagcca
gggagtccatcagacaggaggggcccagagctctgccttgaagagttggaggcagccatc
ccagggtccagagcagttggcgggagcaaggcccgggttcaggcccgccaggtcccctct
gccacggcctcggagtggcggctggcccaggcccagcagaagatccgggagctggctatc
aacatccgcatgaaggaggagctcattggcgagctggtctgcacaggaaaggcagctcag
gccctgaaccgccagcacagccagcgtatccgggagctggagcaggaggcagagcaggtg
cgggccgagctgagtgaaggccagaggcagctgcgggagctcgagggccaggagccccag
gatgccagtgagcggtctcggctccaggagttccgcaggagggttcgctgcgcccagagc
caggtgcaggtgctgaaggaaaagaagcaggccacggagcggctggtgtcactgtcggcc
cagagtgagaagcgactggaggagctggagcggaatgtgcagctcatgcggcagcagcag
gggcagctgcagaggcggcttcgtgaggagacagagcagaagcggcgcctggaggcggag
atgagcaagcggcagcaccgcgtcaaggagctggagctgaagcatgagcagcagcagaag
atcctgaagattaagacggaggagatcgcagccttccagaggaagaggcgcagtggcagc
aacggctctgtggtcagcctggagcagcagcagaagatcgagggaccgaagaagtggctg
gaccaggagatggagaaggtgctacagcagcggcgggcgctggaagagctaggggaggag
ctccacaagcgggaagccattttggccaagaaggaggccctaatgcaagagaagacgggg
ctggagagcaagcgcctgcggtccagccaggccctcaatgaggacattgtgcgtgtgtcc
agccggctggagcacctggagaaggagctgtcggagaagagtgggcagctgcggcagggc
agcacccagagccagcagcagatccgaggggagattgacagcctgcgccaggagaaggac
tcgctgctcaagcagcgcctggagatcgacagcaagctgcggcaggggagcctgctgtcc
cccgaggaggagcggacactgttccagttggatgaggccatcgaggccctggatgctgcc
attgagtacaagaatgaggccatcacatgccgccagcgggtgcttcgggcctcagcctct
ttgctatcccagtgcgagatgaacctcatggccaagctcagctacctctcgtcctctgag
accagagccctcctctgcaagtattttgacaaggtggtgacgctccgagaggagcagcac
cagcagcagattgccttctcggagctggagatgcagctggaggagcagcagaggctggta
tactggctggaggtggccctggaacggcaacgcctggagatggaccgccagctgacgctg
cagcagaaggagcacgagcagaacttgcagctgctcctgcagcagagtcgagatcacctt
ggtgaagggttagcagacagcaagaggcagtatgaggcccggattcaagctctggagaag
gaactaggccgctacatgtggataaaccaggaactgaaacagaagctcggcggtgtgaac
actgcaggccatagcagaggtggggagaagaagagcctgggttcggagggcagacaggct
cctggaaatgaggagctacacccagcgcccgagcttctccggctgtcccccctcactgag
ggggccccccgtacccgggaagagacgcgggacttgatccatgctcccttacccttgacc
ntgaaacgctcgagcctgggtggcgaggagcaggggtcctccgaggagctgaggcagcgg
gaggcggctgagcctctgctagggcgggtgatgcccatgggtgaagcangcctgccctgg
aactttgggccttcatccaaaccctggcgggaactgcgacgagccagcccgggaatgatt
gacgtccggaaaaaccctctgtag

DBGET integrated database retrieval system