KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407824
Entry
100407824         CDS       T03264                                 

Gene name
SP1
Definition
(RefSeq) Sp1 transcription factor
  KO
K04684  transcription factor Sp1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04137  Mitophagy - animal
cjc04350  TGF-beta signaling pathway
cjc04915  Estrogen signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc05016  Huntington disease
cjc05017  Spinocerebellar ataxia
cjc05163  Human cytomegalovirus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05224  Breast cancer
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100407824 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100407824 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100407824 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    100407824 (SP1)
   04927 Cortisol synthesis and secretion
    100407824 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407824 (SP1)
   05202 Transcriptional misregulation in cancer
    100407824 (SP1)
   05231 Choline metabolism in cancer
    100407824 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    100407824 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100407824 (SP1)
   05017 Spinocerebellar ataxia
    100407824 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100407824 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100407824 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100407824 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100407824 (SP1)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100407824 (SP1)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100407824 (SP1)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100407824 (SP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 100407824
NCBI-ProteinID: XP_002752575
Ensembl: ENSCJAG00000018553
UniProt: F7IQ29
LinkDB
Position
9
AA seq 784 aa
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGAFSQARSSSTGSSSSTGGGGQESQPSPL
ALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSK
EQSGNSTNGSSGNESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQT
VDGQQLQFAATGTQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGL
ANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTS
GTTISSASLVSSQPSSSSFFTNANSYSTTTTTSNMGIMNFAPSGSSGTNSQGQTPQRVSG
LQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLS
GQTFTTQAISQETLQNLQLQAVPNSGPIIIRAPTVGPNGQVSWQTLQLQNLQVQNPQAQT
ITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSG
IHVHPIQSLPLAIANAPGDHGAQLGLHGTGGDGIHDDTAGGEEGENSPDAQPQAGRRTRR
EACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWS
YCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSV
GTLPLDSGAGSEGSGSATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINIS
GNGF
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagctgtggtgaagattgagaaagga
gttggtggcaataatgggggcaatggtaatggtggtgccttttcacaggctcgcagcagc
agcacaggcagtagcagcagcactggaggaggagggcaggagtcccagccatcccctttg
gctctgctggcagcaacttgcagcagaattgagtcacccaatgagaacagcaacaactcc
cagggcccaagtcagtcagggggaacaggtgagcttgacctcacagccacacaactttca
cagggtgccaatggctggcagatcatctcttcctcctctggggctacccctacctcaaag
gaacagagtggcaacagtaccaatggcagcagtggcaatgaatcttccaagaatcgcaca
gtctctggtgggcagtatgttgtggctgccactcccaacttacagaaccagcaagttctg
acaggactacctggagtgatgcctaacattcagtatcaagtaatcccacagttccagact
gttgatgggcagcagctgcaatttgctgccactgggacccaagtgcagcaggatggttct
ggtcaaatacagatcataccaggtgcaaaccaacagattatcacaaatcgaggaagtgga
ggcaacattattgctgctatgccaaacctactccagcaggctgtccccctccaaggccta
gctaataatgtactctcaggacagactcagtatgtgaccaatgtaccagtggccctgaat
gggaacatcaccttgctacctgtcaacagcgtttctgcagctaccttgactccgagctct
caggcagtcacgatcagcagctctgggtcccaggagagtggctcacagcctgtcacctca
gggactaccatcagttctgccagcttggtgtcatcacaacccagttccagctcctttttc
accaatgccaatagctactcaactactactaccaccagcaacatgggaattatgaacttt
gctcccagtggatcatcagggaccaactctcaaggccagacaccccagagggtcagtggg
ctgcaggggtctgatgctctgaacatccagcaaaaccagacatctggaggctcactgcaa
gcaggtcagcaaaaagaaggagagcaaaaccagcagacacagcagcaacaaattcttatc
cagcctcagctagttcaagggggacaggccctccaggccctccaagcagcaccattatca
gggcagacctttacaactcaagctatctcgcaggaaaccctccagaacctccagcttcag
gctgttccaaactctggtcccatcatcatccgggcaccaacagtggggcccaatggacag
gtcagttggcagactctacagctgcagaacctccaagttcagaacccacaagctcagaca
atcaccttagccccaatgcagggtgtttccttggggcagaccagcagcagcaacaccact
ctcacacccattgcctcagctgcttccattcctgccggcacagtcactgtgaatgctgct
caactctcctccatgccaggcctccagaccattaacctcagtgcgttgggtacttcagga
atccatgtgcacccaattcaaagcttgccgttggctatagcaaatgctccaggtgatcat
ggagctcagcttggtctccatgggacgggtggtgatggaatacatgatgacacagcaggt
ggagaggaaggagaaaacagcccagatgcccaaccccaagctggtcggaggacccggcgt
gaagcatgcacctgcccctactgtaaagacagtgaaggaaggggttcaggggatcctggc
aaaaagaaacagcatatttgccacatccaaggctgtgggaaagtatatggcaagacctca
cacctgcgggcacacttgcgctggcatactggcgagagaccatttatgtgtacctggtca
tactgtgggaaacgctttacccgttcggatgagctacagaggcacaaacgtacacacaca
ggtgagaagaaatttgcctgccctgagtgtcctaagcgcttcatgaggagtgaccatctg
tcaaaacatatcaagacccaccagaataagaagggaggcccaggtgtagccctgagtgtg
ggcactttgcccctggacagtggggcaggttcagaaggcagcggctctgccactccttca
gcccttattaccaccaatatggtagccatggaggccatctgtccagagggcattgcccgt
cttgccaacagtggcatcaacgtcatgcaggtggcggatctgcagtccattaatatcagt
ggcaatggcttctga

DBGET integrated database retrieval system