KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407858
Entry
100407858         CDS       T03264                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04014  Ras signaling pathway
cjc04390  Hippo signaling pathway
cjc04392  Hippo signaling pathway - multiple species
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05219  Bladder cancer
cjc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100407858 (RASSF1)
   04390 Hippo signaling pathway
    100407858 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100407858 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407858 (RASSF1)
   05206 MicroRNAs in cancer
    100407858 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100407858 (RASSF1)
   05223 Non-small cell lung cancer
    100407858 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 100407858
NCBI-ProteinID: XP_008979942
Ensembl: ENSCJAG00000005126
LinkDB
Position
15
AA seq 340 aa
MSAEPELIELRELAPTGRAGQGRTRLERANALRIARGTARNPARQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVD
EPVEWETPDLSQAEIEKKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDARQGPGRSASVRRHTSFYLPKDIVKHLHVLSRTRAREVIEALLRKFLVVDDPR
KFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSDKALSFILKENDSGEVNWDAFSMPE
LHNFLRILQREEEAHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcggcagaacctgagctcattgagctgcgggagctggcacccaccgggcgcgccggg
cagggccgcactcggctggagcgtgccaacgcgctgcgcatcgcgcggggtactgcgcgt
aaccccgcacggcagctggtcccgggccgtggccaccgcttccagcccgcggggcccgcc
acgcacacgtggtgcgacctctgcggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcgcattgcaagttcacctgccactaccgttgccgcgcgctcgtctgcctggac
tgctgcgggccccgggacctgggctgggaacccgcggtggagcgggacacgaacgtggac
gagcctgtggaatgggagacacctgacctttctcaagctgagattgagaagaagatcaag
gagtacaatggccagatcaatagcaacctcttcatgagcttgaacaaggacggctcttac
acaggcttcatcaaggttcagctgaaactggtgcgccctgtctcagtgccctccagcaag
aagccaccctccttgcaggatgcccggcagggcccaggacggagtgcaagtgtcaggcgc
cacacttccttttacctgcccaaggatattgtcaagcacctgcatgtgttgtcacgcaca
agggcacgtgaggtcattgaggccctgctacgaaagttcttggtggtggatgacccccgc
aagtttgcactttttgagcgggctgagcgtcacggccaagtgtacttgcggaagctgtcg
gatgatgagcagccgctgcggctgcggctcctggcggggcccagtgacaaggccctgagc
ttcatcctgaaggaaaatgactctggggaggtgaactgggacgccttcagcatgcctgaa
ctgcataacttcctgcgtatcctgcagcgggaggaagaggcgcacctccgccagatcctg
cagaagtattcctattgccgccagaagatccaagaggccctgcacgcctgccccctgggg
tga

DBGET integrated database retrieval system