KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408045Help
Entry
100408045         CDS       T03264                                 

Gene name
MPO
Definition
(RefSeq) myeloperoxidase
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00983  Drug metabolism - other enzymes
cjc04145  Phagosome
cjc05202  Transcriptional misregulation in cancer
cjc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100408045 (MPO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100408045 (MPO)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100408045 (MPO)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100408045 (MPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100408045 (MPO)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     100408045 (MPO)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100408045 (MPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 100408045
NCBI-ProteinID: XP_002764017
Ensembl: ENSCJAG00000017310
LinkDB All DBs
Position
Un
AA seq 718 aa AA seqDB search
MKLLLALAGLLAVLGMLQPSEGAAPAVLGEVDTSLVLSCMEEAKQLVDRAYKERRESIKQ
KLRSGSASPMELLSYFKQPVAATRTAARSADYLHVALGLLERKLRSLWQGPFNVTDVLTP
AQLNLLSKSSGCAYQDVGLACPERDEYRTITGMCNNRRSPTLGASNRAFARWLPAEYEDG
FSLPYGWTSGVKRNGFPVPLARAVSNAIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFT
PEPAARTSFFTGVNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACTSSNITI
RNQINALTSFVDASMVYGSEEPLARNLRNGSNQLGLLAVNQRFQDNGRALLPFDNLHDDP
CLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKRLNPRWDGERLYQEA
RKIVGAMVQIITYRDYLPLVLGPAAMRKYLPRYRSYNDSVDPRIANVFTNAFRYGHTLIQ
PFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVD
EIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPEPNTVGELGTVLKNLDL
ARKLMAQYGTPNNIDIWMGGVAEPLEPKGRVGRLLACIIGTQFRKLRDGDRFWWENDGVF
SMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNKHPRDFVNCRTLPALNLTSWRQS
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcttctggccctagcagggctcctggctgttctgggcatgctccagccctct
gaaggtgctgctccagctgtcctgggggaggtggacacctcgttggtgctgagctgcatg
gaggaggccaagcagctggtggacagggcctacaaggagcggcgggaaagcatcaagcag
aagcttcgcagtggctcagccagccccatggaactcctatcctacttcaagcagccagtg
gcagccaccaggactgctgcgagatctgctgactacctgcacgtggccctaggcctgctg
gagaggaagctgcggtccctgtggcaggggccattcaatgtcactgatgtgctaacgccc
gctcagctgaatttgttgtctaagtcaagcggctgcgcttaccaggacgtggggctggct
tgcccggagcgggacgaataccgcaccatcaccggcatgtgcaacaacagacgcagcccc
actctgggggcctccaaccgtgcttttgcgcgctggctgcccgcggagtatgaggacggc
ttctcgcttccctatggctggacgtccggggtcaaacgcaacggcttcccggtgcccctg
gctcgcgcggtctccaacgcgatcgtgcgctttcccacggaccagctgaccccagaccag
gagcgctcactcatgttcatgcagtggggccagctgttggaccacgacctcgacttcact
cccgagccggccgcccggacctccttcttcactggggtcaattgtgagaccagctgcgtg
cagcagccgccctgcttcccgctcaagatcccgcccaacgacccccgcatcaagaaccaa
gccgactgcatcccattcttccgttcctgcccggcctgcaccagcagcaacatcaccatc
cgcaaccagatcaatgcgcttacttccttcgtggacgccagcatggtgtacggcagcgag
gagccgctggccaggaacctgcggaacgggtccaaccagctggggctgctggccgtcaac
cagcgcttccaagacaatgggcgggccctgctgccctttgacaacctgcacgacgacccc
tgtctcctcaccaaccgctcggcgcgcatcccctgcttcctggcaggggacacccgttcc
agtgagatgcctgagctcacctccatgcacaccctcttacttcgggagcacaaccggctg
gccacagagctcaagcgcctgaaccccaggtgggatggagagaggctctaccaggaagcc
cggaagatcgtgggggccatggtccagatcattacttaccgggactacctgcccctggtg
ctggggccagctgccatgaggaaatacctgcccaggtatcgttcctacaatgactcagtg
gacccacgcatcgccaacgttttcaccaatgccttccgctatggccataccctcatccaa
cccttcatgttccgcctggacaatcggtaccagcccatggaacccaaccccagagtccca
cttagcagggtcttttttgcctcctggagggtggtgctggaaggtggcattgaccccatc
ctccggggcctcatggccacccctgccaagctgaatcgtcagaaccaaattgcagtggat
gagatccgggagcgattgtttgagcaggtcatgaggattgggctggacctgcccgctctg
aacatgcagcgcagcagggaccatggcctcccagggtacaatgcctggaggcgcttctgt
gggctcccggagcccaatacggtgggcgagctgggcacagtgctgaagaacctggatttg
gcaaggaaactgatggcgcagtatggcacgcccaacaacatcgacatctggatgggtggc
gtggccgaacccctggagcccaagggccgagtgggccggctgctcgcctgcatcatcggc
acccagttcaggaagctccgggatggtgatcggttttggtgggagaacgacggcgtgttc
agtatgcagcagcgacaggccctggctcagatctccttgccccggatcatctgtgacaac
acgggcatcaccactgtgtctaagaacaacatcttcatgtccaacaaacatccccgggac
tttgtcaactgcaggacgctcccggcattgaacctgacttcctggaggcaatcctag

DBGET integrated database retrieval system