KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408147Help
Entry
100408147         CDS       T03264                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04614  Renin-angiotensin system
cjc04924  Renin secretion
cjc05142  Chagas disease (American trypanosomiasis)
cjc05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100408147 (ACE)
   04614 Renin-angiotensin system
    100408147 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100408147 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100408147 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100408147 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100408147 (ACE)
   04090 CD Molecules [BR:cjc04090]
    100408147 (ACE)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100408147 (ACE)
Peptidases [BR:cjc01002]
 Metallo Peptidases
  Family M2
   100408147 (ACE)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100408147 (ACE)
CD molecules [BR:cjc04090]
 Proteins
  100408147 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100408147
NCBI-ProteinID: XP_008995123
Ensembl: ENSCJAG00000019755
LinkDB All DBs
Position
5
AA seq 1315 aa AA seqDB search
MGAASGHRGPGPPLLPSLPLPLPPLLLLLLLPPPPALALDPGLQPGNFPADEAGAQLFAQ
SYNSSAEHVLFQRIAASWAHDTNITAENARRQEKAALVTQEFAEAWGQKAKELYEPIWQN
FTDPELRKIIGAVRTLGPANLPLAKRQQYNTLLSNMSRTYSTAKVCLPNKTATCWSLDPE
LTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGXXXXXXXXRSWY
ESPTFEDDLEHLYHQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWD
NIYDMVVPFPDKPNLDVTSTMLQQGWNATHMFRVAEEFFVSLGLSPMPPEFWAESMLEKP
ADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDQPVSLREG
ANPGFHEAIGDVLALSVSTPAHLYKIGLLDHVTNDTESDINYLLKMALEKIAFLPFGYLV
DQWRWGVFRGRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYF
VSFVLQFQFHQALCQEAGYQGALHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKEMVGS
DALDAQPLLDYFQPVTQWLQEQNQKNGEVLGWPEYQWRPPLPDNYPEGIDLVTDEAEARK
FLEEYDRTSQVVWTDYAEANWNYYTNITRETSSVLLQKNMQIANYTLQYGTQARRFDVSH
FQNTTIKRILKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHTNGSCLQLEPDLT
NVMATSRKYEELLWAWKGWRDKAGRTILQFYPKYVEFINKAARLNGYVDAGDSWRSMYEM
PSLEQDLERLFQQLQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNI
YDLVVPFPSATLMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTD
GREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALRDGAN
PGFHEAIGDVLALSVSTPKHLHSLNLLSSEGDSFENNINFLMKMALEKIAFIPFSYLVDQ
WRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVS
FIIQFQFHEALCQVAGHTGPLHKCDIYQSKEAGQRLAAAMKLGFSQPWPEAMQLITGQPN
MSASAMLSYFKPLLDWLRAENELHGEKLGWPQYNWTPNSARSEGPLRDSGRVSFLGLDLE
PQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHHSLRQPHHGPQFGSEVELRHS
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcctcaggccaccggggaccagggccgccgctgctgccgtcgctgccgctg
ccgctgccgccgctgctactgctgctgctgctgccgccgccgcccgccctggcgctggac
cccgggctgcagcccggcaactttcccgccgacgaggccggggcgcagctttttgcgcag
agctacaactcgagcgccgagcatgtgctgttccagagaatagccgccagctgggcgcac
gacacgaacatcacagcggagaatgcgcggcgccaggagaaagcagccctggtcacccag
gagtttgcagaggcctggggccagaaggccaaggagctgtatgaaccgatctggcagaac
ttcacggacccggagttgcgcaagatcatcggagctgtgcgcaccctgggccctgccaac
ctgcccctagctaagcggcagcagtacaacacccttctaagcaacatgagcaggacctac
tccaccgccaaggtctgcctccccaacaagactgccacctgctggtccctggacccagaa
ctcaccaacatcctggcttcctcgagaagctacgccatgctcctgtttgcctgggagggt
tggcacaatgccgcgggaatcccgctgaaaccgctgtacgaggatttcactgccctcagc
aatgaagcctacaagcaggatggnnnnnnnnnnnnnnnnnnnnnnnngcgctcctggtac
gaatcccccaccttcgaggacgatctggagcacctctaccatcagctggagcccctctac
ctgaacctccatgccttcgtccgccgcgcactccatcgccgatacggggacagatacatc
aacctcaggggacccatccctgctcatctgctgggagacatgtgggcccagagctgggac
aacatctacgacatggtggtgcctttcccagacaagcccaaccttgatgtcactagtact
atgctgcagcagggctggaatgccacacacatgttccgggtggcagaggagttcttcgtc
tccctggggctctcccccatgcctccagagttctgggcagagtcgatgctggagaagccg
gccgacgggcgggaggtggtgtgccatgcctcagcttgggatttctacaatcggaaagac
ttcaggatcaagcagtgcacacgggtcacgatggaccagctctccactgtgcaccatgag
atgggccacgtgcagtactacctacagtacaaggaccagcccgtctccctgcgtgagggt
gccaaccccggcttccatgaggccattggggacgtgctggcgctctcagtctccactcct
gcacatctgtataaaatcggcttactggatcatgtcaccaatgacacggaaagtgacatc
aattacttgctaaagatggcactggaaaaaattgccttcctgccctttggctacttggtg
gaccagtggcgctggggagtctttagggggcgtacccccccttcccgctacaacttcgac
tggtggtatcttcgaaccaagtatcaggggatctgtcctcctgtcacccgaaatgaaacc
cactttgatgctggagcgaagtttcatgtcccaaatgtgacaccatacatcaggtacttt
gtgagttttgtcctgcagttccagttccatcaagccctgtgccaggaggcaggctatcag
ggtgcactacaccagtgtgacatctaccagtccaccaaggcaggggccaagctccggaaa
gtgctgcaggccggctcctccaggccctggcaggaagtgctgaaggagatggttggctca
gatgccctggatgcccagccactgctcgactacttccagccagtcacccagtggctgcag
gagcagaaccagaagaacggcgaggtcctgggctggccagagtaccagtggcgcccaccg
ttgcccgacaactacccagaaggcattgacctggtgaccgatgaggctgaggccaggaag
ttcttggaggaatatgaccgcacatcccaggtggtgtggacggattacgccgaggccaac
tggaattactacaccaacatcaccagagagaccagcagcgttctgctgcagaagaacatg
cagatagccaactacacgctgcagtacggcacccaggccaggaggtttgatgtgagccac
ttccagaacaccactatcaagcggatcctcaagaaggttcaggacctagaacgggcagca
ctgcctgcccaggagctggaggagtacaacaagatcctgttggacatggaaaccacctac
agcgtggccactgtttgccacacgaatggcagctgcctgcagctcgagccagatctgacg
aacgtgatggccacatcccggaaatacgaagaactgttatgggcgtggaagggctggcga
gacaaggcggggaggaccattctccagttttacccaaaatacgtggaattcatcaacaag
gcagcccggctcaatggctatgtagatgcaggggactcctggaggtctatgtatgagatg
ccatccctggagcaagacctggagcggctcttccagcagctgcagccgctctacctgaac
ctgcacgcctacgtgcgccgggccctgcaccgccactacggggcccagcacatcaacctg
gagggccccatccctgctcacctgctggggaacatgtgggcacagacctggtccaacatc
tatgacttggtggtgcccttcccttcagccaccttgatggacaccacggaggccatgcta
aagcagggctggacacccaggaggatgtttaaggaggctgatgatttcttcacctccctg
gggctgctgcccgtgcctcctgagttctggaacaagtcaatgctggaaaagccaaccgac
gggcgagaggtggtctgccatgcctcggcctgggacttctacaacggcaaggacttccgg
atcaagcagtgcaccactgtgaacttggaggacctggtggtggcccaccacgaaatgggc
cacatccagtatttcatgcagtacaaagacttgcccgtggccttgagggacggtgccaac
cccggcttccatgaggccattggggatgtgctagccctctcagtatctacacccaagcac
ctgcacagtctcaacctgctgagcagcgagggtgacagctttgagaacaacatcaacttt
ctgatgaagatggcgctggaaaagattgccttcatccccttcagctatctcgtggatcag
tggcgctggagggtatttgatggaagcatcaccaaggagaactacaaccaggagtggtgg
agcctcaggctgaagtaccagggcctctgccccccggtgcccaggactcaaggtgacttc
gatccaggggccaagttccacattccttctagtgtgccttacatcaggtacttcgtcagc
ttcatcatccagttccagttccacgaggccctgtgccaggtggctggccacacaggcccc
ctgcacaagtgtgacatctaccagtccaaggaggccgggcagcgcctggcagccgccatg
aagctgggcttcagtcagccgtggccggaagccatgcagctgatcacaggccagcccaac
atgagcgcctcggccatgctgagctacttcaagccgctactagactggctccgtgcggag
aatgagctgcacggggagaagctgggctggccacagtacaactggacacccaactccgct
cgctcagaaggtcccctccgagacagcggccgcgtcagcttcctaggcctggacctggag
ccacagcaggcccgggtgggccagtggctgctgctcttcctgggcatcgccctgctggtg
gccaccctaggcctcagccagcggctcttcagcatccgccaccacagcctccgccagccc
caccacgggccccagtttggctctgaggtagagctgagacactcctga

DBGET integrated database retrieval system