KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408147Help
Entry
100408147         CDS       T03264                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04614  Renin-angiotensin system
cjc04924  Renin secretion
cjc05142  Chagas disease (American trypanosomiasis)
cjc05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100408147 (ACE)
   04614 Renin-angiotensin system
    100408147 (ACE)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100408147 (ACE)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    100408147 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100408147 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100408147 (ACE)
   04090 CD molecules [BR:cjc04090]
    100408147 (ACE)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100408147 (ACE)
Peptidases [BR:cjc01002]
 Metallo Peptidases
  Family M2
   100408147 (ACE)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100408147 (ACE)
CD molecules [BR:cjc04090]
 Proteins
  100408147 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100408147
NCBI-ProteinID: XP_008995123
Ensembl: ENSCJAG00000019755
LinkDB All DBs
Position
5
AA seq 1315 aa AA seqDB search
MGAASGHRGPGPPLLPSLPLPLPPLLLLLLLPPPPALALDPGLQPGNFPADEAGAQLFAQ
SYNSSAEHVLFQRIAASWAHDTNITAENARRQEKAALVTQEFAEAWGQKAKELYEPIWQN
FTDPELRKIIGAVRTLGPANLPLAKRQQYNTLLSNMSRTYSTAKVCLPNKTATCWSLDPE
LTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGXXXXXXXXRSWY
ESPTFEDDLEHLYHQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWD
NIYDMVVPFPDKPNLDVTSTMLQQGWNATHMFRVAEEFFVSLGLSPMPPEFWAESMLEKP
ADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDQPVSLREG
ANPGFHEAIGDVLALSVSTPAHLYKIGLLDHVTNDTESDINYLLKMALEKIAFLPFGYLV
DQWRWGVFRGRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYF
VSFVLQFQFHQALCQEAGYQGALHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKEMVGS
DALDAQPLLDYFQPVTQWLQEQNQKNGEVLGWPEYQWRPPLPDNYPEGIDLVTDEAEARK
FLEEYDRTSQVVWTDYAEANWNYYTNITRETSSVLLQKNMQIANYTLQYGTQARRFDVSH
FQNTTIKRILKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHTNGSCLQLEPDLT
NVMATSRKYEELLWAWKGWRDKAGRTILQFYPKYVEFINKAARLNGYVDAGDSWRSMYEM
PSLEQDLERLFQQLQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNI
YDLVVPFPSATLMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTD
GREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALRDGAN
PGFHEAIGDVLALSVSTPKHLHSLNLLSSEGDSFENNINFLMKMALEKIAFIPFSYLVDQ
WRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVS
FIIQFQFHEALCQVAGHTGPLHKCDIYQSKEAGQRLAAAMKLGFSQPWPEAMQLITGQPN
MSASAMLSYFKPLLDWLRAENELHGEKLGWPQYNWTPNSARSEGPLRDSGRVSFLGLDLE
PQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHHSLRQPHHGPQFGSEVELRHS
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcctcaggccaccggggaccagggccgccgctgctgccgtcgctgccgctg
ccgctgccgccgctgctactgctgctgctgctgccgccgccgcccgccctggcgctggac
cccgggctgcagcccggcaactttcccgccgacgaggccggggcgcagctttttgcgcag
agctacaactcgagcgccgagcatgtgctgttccagagaatagccgccagctgggcgcac
gacacgaacatcacagcggagaatgcgcggcgccaggagaaagcagccctggtcacccag
gagtttgcagaggcctggggccagaaggccaaggagctgtatgaaccgatctggcagaac
ttcacggacccggagttgcgcaagatcatcggagctgtgcgcaccctgggccctgccaac
ctgcccctagctaagcggcagcagtacaacacccttctaagcaacatgagcaggacctac
tccaccgccaaggtctgcctccccaacaagactgccacctgctggtccctggacccagaa
ctcaccaacatcctggcttcctcgagaagctacgccatgctcctgtttgcctgggagggt
tggcacaatgccgcgggaatcccgctgaaaccgctgtacgaggatttcactgccctcagc
aatgaagcctacaagcaggatggnnnnnnnnnnnnnnnnnnnnnnnngcgctcctggtac
gaatcccccaccttcgaggacgatctggagcacctctaccatcagctggagcccctctac
ctgaacctccatgccttcgtccgccgcgcactccatcgccgatacggggacagatacatc
aacctcaggggacccatccctgctcatctgctgggagacatgtgggcccagagctgggac
aacatctacgacatggtggtgcctttcccagacaagcccaaccttgatgtcactagtact
atgctgcagcagggctggaatgccacacacatgttccgggtggcagaggagttcttcgtc
tccctggggctctcccccatgcctccagagttctgggcagagtcgatgctggagaagccg
gccgacgggcgggaggtggtgtgccatgcctcagcttgggatttctacaatcggaaagac
ttcaggatcaagcagtgcacacgggtcacgatggaccagctctccactgtgcaccatgag
atgggccacgtgcagtactacctacagtacaaggaccagcccgtctccctgcgtgagggt
gccaaccccggcttccatgaggccattggggacgtgctggcgctctcagtctccactcct
gcacatctgtataaaatcggcttactggatcatgtcaccaatgacacggaaagtgacatc
aattacttgctaaagatggcactggaaaaaattgccttcctgccctttggctacttggtg
gaccagtggcgctggggagtctttagggggcgtacccccccttcccgctacaacttcgac
tggtggtatcttcgaaccaagtatcaggggatctgtcctcctgtcacccgaaatgaaacc
cactttgatgctggagcgaagtttcatgtcccaaatgtgacaccatacatcaggtacttt
gtgagttttgtcctgcagttccagttccatcaagccctgtgccaggaggcaggctatcag
ggtgcactacaccagtgtgacatctaccagtccaccaaggcaggggccaagctccggaaa
gtgctgcaggccggctcctccaggccctggcaggaagtgctgaaggagatggttggctca
gatgccctggatgcccagccactgctcgactacttccagccagtcacccagtggctgcag
gagcagaaccagaagaacggcgaggtcctgggctggccagagtaccagtggcgcccaccg
ttgcccgacaactacccagaaggcattgacctggtgaccgatgaggctgaggccaggaag
ttcttggaggaatatgaccgcacatcccaggtggtgtggacggattacgccgaggccaac
tggaattactacaccaacatcaccagagagaccagcagcgttctgctgcagaagaacatg
cagatagccaactacacgctgcagtacggcacccaggccaggaggtttgatgtgagccac
ttccagaacaccactatcaagcggatcctcaagaaggttcaggacctagaacgggcagca
ctgcctgcccaggagctggaggagtacaacaagatcctgttggacatggaaaccacctac
agcgtggccactgtttgccacacgaatggcagctgcctgcagctcgagccagatctgacg
aacgtgatggccacatcccggaaatacgaagaactgttatgggcgtggaagggctggcga
gacaaggcggggaggaccattctccagttttacccaaaatacgtggaattcatcaacaag
gcagcccggctcaatggctatgtagatgcaggggactcctggaggtctatgtatgagatg
ccatccctggagcaagacctggagcggctcttccagcagctgcagccgctctacctgaac
ctgcacgcctacgtgcgccgggccctgcaccgccactacggggcccagcacatcaacctg
gagggccccatccctgctcacctgctggggaacatgtgggcacagacctggtccaacatc
tatgacttggtggtgcccttcccttcagccaccttgatggacaccacggaggccatgcta
aagcagggctggacacccaggaggatgtttaaggaggctgatgatttcttcacctccctg
gggctgctgcccgtgcctcctgagttctggaacaagtcaatgctggaaaagccaaccgac
gggcgagaggtggtctgccatgcctcggcctgggacttctacaacggcaaggacttccgg
atcaagcagtgcaccactgtgaacttggaggacctggtggtggcccaccacgaaatgggc
cacatccagtatttcatgcagtacaaagacttgcccgtggccttgagggacggtgccaac
cccggcttccatgaggccattggggatgtgctagccctctcagtatctacacccaagcac
ctgcacagtctcaacctgctgagcagcgagggtgacagctttgagaacaacatcaacttt
ctgatgaagatggcgctggaaaagattgccttcatccccttcagctatctcgtggatcag
tggcgctggagggtatttgatggaagcatcaccaaggagaactacaaccaggagtggtgg
agcctcaggctgaagtaccagggcctctgccccccggtgcccaggactcaaggtgacttc
gatccaggggccaagttccacattccttctagtgtgccttacatcaggtacttcgtcagc
ttcatcatccagttccagttccacgaggccctgtgccaggtggctggccacacaggcccc
ctgcacaagtgtgacatctaccagtccaaggaggccgggcagcgcctggcagccgccatg
aagctgggcttcagtcagccgtggccggaagccatgcagctgatcacaggccagcccaac
atgagcgcctcggccatgctgagctacttcaagccgctactagactggctccgtgcggag
aatgagctgcacggggagaagctgggctggccacagtacaactggacacccaactccgct
cgctcagaaggtcccctccgagacagcggccgcgtcagcttcctaggcctggacctggag
ccacagcaggcccgggtgggccagtggctgctgctcttcctgggcatcgccctgctggtg
gccaccctaggcctcagccagcggctcttcagcatccgccaccacagcctccgccagccc
caccacgggccccagtttggctctgaggtagagctgagacactcctga

DBGET integrated database retrieval system