KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408313
Entry
100408313         CDS       T03264                                 

Gene name
CBL
Definition
(RefSeq) Cbl proto-oncogene
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04144  Endocytosis
cjc04910  Insulin signaling pathway
cjc05100  Bacterial invasion of epithelial cells
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100408313 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100408313 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100408313 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100408313 (CBL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100408313 (CBL)
   05205 Proteoglycans in cancer
    100408313 (CBL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100408313 (CBL)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100408313 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100408313 (CBL)
   04121 Ubiquitin system [BR:cjc04121]
    100408313 (CBL)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100408313 (CBL)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100408313 (CBL)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    100408313 (CBL)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 zf-RING_4
Other DBs
NCBI-GeneID: 100408313
NCBI-ProteinID: XP_002754480
Ensembl: ENSCJAG00000014015
UniProt: F7CSE3
LinkDB
Position
11
AA seq 909 aa
MAGNVKKSSGAGSGGGSGGSGSGGLIGLMKDAFQPHHHHHHHHHLSPHPPGTVDKKMVEK
CWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVF
MENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDT
FRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISV
FEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCT
RLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQ
DHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPF
CRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKV
ERPPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPT
FRDLPPPPPPDRPYSVGSESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKV
PVSAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPE
CDHPKIKPSSSANAIYSLAARPLPVPKLPPGEQGEDEEDTEYMTPSSRPLRPLDTSQSSR
ACDCDQQIDSCTYEAMYNIQSQAPSVTESSTFGEGNLAAAHANTGPEESENEDDGYDVPK
PPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAV
NGQQGSSAASSSAATASPQLSSEIENLLSQGYSYQDIQKALVIAQNNIEMAKNILREFVS
ISSPAHVAT
NT seq 2730 nt   +upstreamnt  +downstreamnt
atggccggcaacgtaaagaagagctctggggccgggagcggcggcggctccgggggctcg
ggctctggcggcctgattgggctcatgaaggacgccttccagccgcaccaccaccaccac
caccaccaccacctcagcccccacccgccggggaccgtggacaagaagatggtggagaag
tgctggaagctcatggacaaggtggtgcggttgtgtcagaacccaaagctggcgctaaag
aatagcccaccttatatcttagacctgctaccagatacctaccagcatctccgtactatc
ttgtcaagatatgaggggaagatggagacacttggagaaaacgagtactttagggtgttc
atggagaatttgatgaagaaaactaagcaaaccataagcctcttcaaggagggaaaagag
agaatgtatgaggagaattctcagcctaggcgaaacttaaccaaactgtccctcatcttc
agccacatgctggcagaactaaaaggaatctttccaagtggactctttcaaggagacaca
tttcggattactaaagcagatgctgcggaattttggagaaaagctttcggggaaaagaca
atagtcccttggaagagctttcgacaggctctacatgaagtacatcccatcagttctggg
ctggaagccatggctctgaaatccactattgatctgacctgtaatgattatatttcagtt
tttgaatttgacatctttacacgactctttcagccctggtcctctttgctcaggaattgg
aacagtcttgctgtaactcatcctggttacatggcttttttgacatatgacgaagtgaaa
gctcggctccagaaattcattcacaaacctggcagttacatcttccggctgagctgtact
cgtctgggtcagtgggctattgggtatgttactgctgatgggaacattcttcagacaatc
cctcacaataaacctctcttccaagcactgattgatggcttcagggaaggcttctatttg
tttcctgatggacgaaatcagaatcctgatctgactggcttatgtgaaccaactccccaa
gaccatatcaaagtgacccaggaacaatatgaattatactgtgagatgggctccacattc
caactgtgtaaaatatgtgctgaaaatgataaggatgtaaagattgagccctgtggacac
ctcatgtgcacatcctgtcttacatcctggcaggaatcagaaggtcagggctgtcctttc
tgccgatgtgaaattaaaggtactgaaccaatcgtggtagatccgtttgatcctagaggc
agtggcagcctgttgaggcaaggagcagagggagctccctccccaaattatgatgatgat
gacgatgaacgagctgatgatactctcttcatgatgaaggaattggctggtgccaaggtg
gaacggcctccttctccattctccatggccccacaagcttcccttcctccagtgccacca
cgacttgaccttctgccgcagcgagtgtgtgttccctcaagtgcttctgctcttggaact
gcttctaaggctgcttctggctcccttcataaagacaaaccattgccagtacctcccaca
tttcgagatcttccaccaccaccgcctccagaccggccatattctgttggatcagaatcc
aggcctcagagacgccccctgccttgtacaccaggcgattgtccatccagagacaaactg
ccccctgtcccctctagccgccttggagactcatggttgccccggccaatccccaaagta
cccgtatctgccccaagttccagtgatccctggacaggaagagaattaaccaaccggcac
tcacttccattttcattgccttcacaaatggagcccagaccagatgtgcctaggctcgga
agcacgttcagtctggatacctccatgagtatgaatagcagcccattagtaggtccagag
tgtgaccaccccaaaatcaaaccttcctcatctgccaatgccatttattctctggctgcc
agacctcttcctgtgccaaaactgccacctggggaacagggtgaggatgaagaggacaca
gagtacatgactccctcttccaggcctctacggcctttggatacatcccagagttcacga
gcatgtgattgtgaccagcagattgatagctgtacatatgaagcaatgtataatattcag
tctcaggcgccatctgtcaccgagagcagcacctttggtgaagggaatttggctgcagcc
catgccaacactggtcctgaggaatcagaaaatgaggatgatgggtatgatgtcccaaag
ccacctgtgccggcggtgctggcccgccgaacgctctcggatatctctaatgccagctcc
tcctttggctggttgtctctggatggtgatcccacaacaaatgtcaccgaaggttcccaa
gttcccgagaggcctcctaaaccattccctcggagaatcaactctgaacggaaagctgtc
aacggtcagcaaggtagcagtgctgcctcctcctctgctgccaccgcctcacctcagctc
tccagtgagattgagaacctcctgagtcagggatactcctaccaggacatccagaaagct
ttggtcattgcccagaacaacatcgagatggccaaaaacatcctccgggaatttgtttcc
atttcttctcctgcccatgtagctacctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409801
Entry
100409801         CDS       T03264                                 

Gene name
CBLB
Definition
(RefSeq) Cbl proto-oncogene B
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04144  Endocytosis
cjc04625  C-type lectin receptor signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04910  Insulin signaling pathway
cjc05162  Measles
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100409801 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100409801 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100409801 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100409801 (CBLB)
   04660 T cell receptor signaling pathway
    100409801 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100409801 (CBLB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100409801 (CBLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100409801 (CBLB)
   04121 Ubiquitin system [BR:cjc04121]
    100409801 (CBLB)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100409801 (CBLB)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100409801 (CBLB)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    100409801 (CBLB)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 UBA zf-RING_4
Other DBs
NCBI-GeneID: 100409801
NCBI-ProteinID: XP_017820765
Ensembl: ENSCJAG00000004804
LinkDB
Position
15
AA seq 981 aa
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTAPLANSLSEKTRDPVEEDDDESRIPSSHPISLN
SQLSHCHNVKPPVRSCDNGHCILNGTHGPSSEKKSNIPDLGIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSRQDLFLLPSDPFFDASGQVPLPPARRLPGENVKTNRTSQDYDQLPSSSDSSQA
PARPPKPRPRRTAPEIHHRKPHGPEAAMENVDAKIAKLMGEGYAFEEVKRALEIAQNNVE
VARSILREFAFPPPISPRLNL
NT seq 2946 nt   +upstreamnt  +downstreamnt
atggcaaactcaatgaatggcagaaaccctggtggtcgaggaggaaacccccgaaaaggt
cgaattttgggtattattgatgctattcaggatgcagttggaccccctaagcaagctgcg
gcagatcgcaggaccgtggagaagacttggaaactcatggacaaagtggtaagactgtgc
caaaatcccaaacttcagttgaaaaatagcccaccatatatacttgatattttgcctgat
acatatcagcatttacgacttatactgagtaaatatgatgacaaccagaaacttgcccaa
ctcagtgagaatgagtactttaaaatctacattgatagccttatgaaaaagtcaaaacgg
gcaatcagactctttaaagaaggcaaggagagaatgtatgaagaacagtcacaggacaga
cgaaatctcacgaaactgtcccttatcttcagtcacatgctggcagaaattaaagcaatc
tttcccaatggtcaattccagggagataactttcgtatcacaaaagcagatgctgctgaa
ttctggagaaagttttttggagacaaaactattgtaccatggaaagtattcagacagtgc
cttcatgaagtccaccaaattagctctggcttggaagcaatggctctcaaatcaacaatt
gatttaacttgcaatgattacatttcagtttttgaatttgatatttttaccaggctgttt
cagccttggggctctattttgcggaattggaatttcttagctgtgacacatccagggtac
atggcatttctcacgtatgatgaagttaaagcacgactgcagaaatatagcaccaaacct
ggaagctacatttttcggttaagttgcactcgattgggacagtgggccattggctatgtg
accggggatggcaatatcttacagaccatacctcataacaagcccttatttcaagccctg
attgatggcagcagggaaggattttacctgtatcctgatgggaggagttataatcctgat
ttaactggattatgtgaacctacacctcatgatcatataaaagtgacacaggaacaatat
gaattatattgtgaaatgggctccacttttcagctctgtaagatttgtgcagagaacgac
aaagacgtcaagattgagccttgtgggcatttgatgtgcacctcttgcctaacagcatgg
caggagtcggatggtcagggctgccctttctgtcgttgtgaaataaaaggaactgagccc
ataatcgtggacccctttgatccaagagatgaaggttccaggtgttgcagcatcattgac
ccctttggcatgccgatgctcgacttggacgacgatgatgatcgagaggagtccttgatg
atgaatcggttggcgaacgtccgaaagtgcactgacaggcagaactcaccagtcacatca
ccaggatcctctccccttgcccagagaagaaagccacagcctgacccactccagatccca
catctaagcctgccaccagtgcctcctcgcctggatctaattcagaaaggcatagttaga
tctccctgtggcagcccaactggttcaccaaagtcttctccttgcatggtgagaaaacaa
gataaaccactcccagcaccacctcctcccttaagggatcctcctccaccgccacctgaa
agacctcccccaatcccaccagacaacagactgagtagacacatccatcatgtggaaagt
gtgccttccagagacccgccaatgcctcttgaagcatggtgccctcgagatgtgtttggg
actaatcagcttgtgggatgtcgactcctaggcgagggctctccaaaacccggaataaca
gcgagttcaaatgtaaatggaaggcacagtagagtgggctctgacccagtgcttatgcga
aaacacagacgccatgatttgcctttagaaggagctaaggtcttttccaatggtcatctt
ggaagtgaagaatatgatgttcctccccggctttctcctcctcctccagttaccaccctt
ctccctagcataaagtgtactgctccgttagcaaattctctttcagagaaaacaagagac
ccagtagaggaagacgatgatgaatccaggattccttcatcccatcccatttccctgaac
tcacaactatctcattgtcataacgtaaaacctcctgttcggtcttgtgataatggtcat
tgtatactgaatggaacacatggtccatcttcagagaagaaatcgaacatccctgactta
ggcatatatttaaagggagatgtgtttgattcagcctctgatccagtgccattaccacct
gccaggcctccaactcgggacaatccaaagcatggttcttcactcaacaggacgccctct
gattatgatcttctcatccctccattaggtgaagatgcttttgatgccctccctccatca
ctcccacctcccccgcctcctgcaaggcatagtctcattgaacattcgaaacctcctggc
tccagtagccggccatcctcacgacaggatctttttcttctgccttcagacccctttttt
gatgcaagtggccaagttcctttgcctcccgctagaagattaccaggtgaaaatgtcaaa
actaacagaacatcacaggactatgatcagcttccttcatcttcagacagttcacaagca
ccagccagacccccaaaaccacgaccccgcaggactgcaccagaaattcaccacaggaaa
ccccatgggcctgaggcggcaatggaaaacgtcgatgcaaaaattgcaaaactcatggga
gagggttatgcctttgaagaggtgaagagagccttagagatagcccagaataatgttgaa
gttgcccggagcatcctccgagaatttgccttccctccacctatttccccacgtctaaat
ctatag

DBGET integrated database retrieval system