KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408354Help
Entry
100408354         CDS       T03264                                 

Gene name
SLC22A5
Definition
(RefSeq) solute carrier family 22 member 5
  KO
K08202  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 4/5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100408354 (SLC22A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100408354 (SLC22A5)
Transporters [BR:cjc02000]
 Solute Carrier Family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   100408354 (SLC22A5)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    100408354 (SLC22A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 100408354
NCBI-ProteinID: XP_017825182
Ensembl: ENSCJAG00000012972
LinkDB All DBs
Position
2
AA seq 581 aa AA seqDB search
MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIGTPAHRCRVPDAANLSS
AWRNHSVPLRLQDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLELESCLDGWEFS
QDVYLSTIVTEQDSGAHNAMKNRMGRKLHFCLPAQWNLVCEDDWKAPLTISLFFVGVLLG
SFISGQLSDRFGRKNVLFVTMGMQTGFSFLQLFSKNFEMFVVLFVFVGMGQISNYVAAFV
LGTEILGKSVRIIFSTLGVCIFYAFGYMVLPLFAYFIRDWRMLLLALTVPGVLCVALWWF
IPESPRWLISQGRFEEAEVIIRKAAKANGIAVPSTIFDPSELQDLSSKKQQSHSILDLLR
TRNIRMVTIMSIILWMTISVGYFGLSLDTPNLHGDIYVNCFLSATVEVPAYVLAWLLLRY
LPRRYSMATALFLGGSVLLFVQLVPPDLYYLTTALVMVGKFGITAAFSMVYVYTAELYPT
VVRNMGVGVSSTASRLGSILSPYFGYLGVYDRFLPYILMGSLTILTAILTLFLPESFGTP
LPDTIDQMLRVKGMKHRQTPSHTRMLKDGEERPTILKSTAL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcgggactacgacgaggtgaccgccttcctgggcgagtgggggcccttccagcgcctc
atcttcttcctgctcagcgccagcatcatccccaatggcttcaccggcctgtcctccgtg
ttcctgatagggaccccggcgcaccgctgccgggtgccggacgccgctaacctgagcagc
gcctggcgcaaccacagtgtcccgctgcggctgcaggacggccgcgaggtgccccacagc
tgccgccgctaccggctcgccaccatcgccaacttctcggcgctcgggctggagccgggg
cgcgacgtggacctggggcagctggagctggagagctgcctggatggctgggagttcagc
caggacgtctacctgtccaccatcgtgaccgagcaagacagtggggcccacaacgctatg
aaaaacaggatggggaggaaacttcatttctgccttcctgcccagtggaacctggtgtgt
gaggacgactggaaggccccactcaccatctccttgttcttcgtgggtgtgctgttgggc
tccttcatttcggggcagctgtcagacaggtttggccggaagaatgtgctgtttgtgacc
atgggcatgcagacaggcttcagcttcctgcagctcttctcgaagaactttgagatgttt
gtcgtgctgtttgtctttgtaggcatgggccagatctccaactacgtggcagcatttgtc
ctggggacagaaattcttggcaagtcagttcgtataatattctctacgttaggagtgtgc
atattttatgcatttggctacatggtgctgccactgtttgcttacttcatccgagactgg
cggatgctgctgctggcgctgacggtgccaggggtgctgtgtgtggcactctggtggttc
attcctgagtccccccgatggctcatctctcagggacgatttgaagaggcagaggtgatc
atccgcaaggctgccaaagccaatgggattgctgtcccctccaccatctttgacccgagt
gagttacaagacctaagttccaagaagcagcagtcccacagcattctggatctgcttcga
acccggaatatccggatggtcaccatcatgtccataattctgtggatgaccatatcagtg
ggctatttcgggctttcccttgatactcctaacttgcatggggacatctatgtgaactgc
ttcctttcagcaacggttgaagtcccagcatacgtgttggcctggctgctgctgcggtat
ttgccccggcgctattccatggccactgccctcttcctgggtggcagtgtccttctcttc
gtgcagctggtgcccccagacttgtattatttgactacagccctggtgatggtaggcaag
tttggaatcacagctgccttttccatggtctacgtgtacacagctgagctgtatcccaca
gtggtgagaaacatgggtgtgggagttagctccacagcatcccgcctgggcagcatcctg
tctccctactttggttacctaggtgtctacgaccgcttcctgccctacattctcatggga
agtctgaccatcctgacagccatcctcactttgtttctcccagagagcttcggtacccca
ctcccagacaccattgaccagatgctaagggtcaaaggaatgaaacacagacaaactcca
agtcacacaaggatgttaaaagatggtgaagaaaggcccacaattcttaaaagcacagcc
ctctaa

DBGET integrated database retrieval system