KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408399
Entry
100408399         CDS       T03264                                 

Gene name
IGF1R
Definition
(RefSeq) insulin like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04114  Oocyte meiosis
cjc04140  Autophagy - animal
cjc04144  Endocytosis
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04730  Long-term depression
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05205  Proteoglycans in cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100408399 (IGF1R)
   04014 Ras signaling pathway
    100408399 (IGF1R)
   04015 Rap1 signaling pathway
    100408399 (IGF1R)
   04066 HIF-1 signaling pathway
    100408399 (IGF1R)
   04068 FoxO signaling pathway
    100408399 (IGF1R)
   04151 PI3K-Akt signaling pathway
    100408399 (IGF1R)
   04152 AMPK signaling pathway
    100408399 (IGF1R)
   04150 mTOR signaling pathway
    100408399 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100408399 (IGF1R)
   04140 Autophagy - animal
    100408399 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100408399 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100408399 (IGF1R)
   04520 Adherens junction
    100408399 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    100408399 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100408399 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    100408399 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    100408399 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    100408399 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    100408399 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100408399 (IGF1R)
   05202 Transcriptional misregulation in cancer
    100408399 (IGF1R)
   05205 Proteoglycans in cancer
    100408399 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100408399 (IGF1R)
   05214 Glioma
    100408399 (IGF1R)
   05218 Melanoma
    100408399 (IGF1R)
   05215 Prostate cancer
    100408399 (IGF1R)
   05224 Breast cancer
    100408399 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100408399 (IGF1R)
   01522 Endocrine resistance
    100408399 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100408399 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100408399 (IGF1R)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100408399 (IGF1R)
Protein kinases [BR:cjc01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100408399 (IGF1R)
CD molecules [BR:cjc04090]
 Proteins
  100408399 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 100408399
NCBI-ProteinID: XP_017828763
LinkDB
Position
6
AA seq 1366 aa
MKSSSGGGSPTSLWGLLFLSTVLVLWPTSGEICGPGIDIRNDFHQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVVGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTSLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
VCPGAMEENPMCEKTAINNEYNFRCWTTNRCQKMCPSACGKRACTDNNECCHPECLGSCS
APDNDTACVACLHYYHAGICVPTCPPNTYRFEGWRCVDRQFCASIVSSENSENNKFVIHD
GECMQDCPSGFIRDTTHSMQCIPCKGPCPKVCDEQMAKSIDSVTSAQMLQGCTIFKGNLL
INIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEDQLEGNYSFY
VLDNQNLQQLWDWDHHNLTIRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQNKGDINTRN
NGERASCESDVLHFTSTTTWKNRVIITWHRYRPPDYRDLISFTVFYKEAPFKNVTEYDGQ
DACGSNSWNMVDVDLPQNKDVEPGVLLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEI
LYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQQQPQDGYLYRHN
YCSKDKIPIRKYAGGSIDVEEVTENPKTEVCGTEKGPCCACPKTEAEKQAEKEEAEYRKV
FENFLHNSIFVPRPDRKRRDVIQVANSSTSSRSRNTTAVDTYNITDLDELETEYPFFESR
VDNRERTVISNLRPFTLYRIDIHSCNHEAERLGCSASNFVFARTMPADGADDIPGPVTWE
PRPENSIFLKWPEPENPNGLXLMYEIKYGAQVEDQRECVSRQDYRKYGGAKLNRLNPGNY
TARIQATSLSGNGSWTEPVFFYVQAKTGYENFIHLIIALPIAVLLIVGGLVIMLYVFHRK
RSNSRLGNGVLYASVNPEYFSAADVYIPDEWEVAREKITMSRELGQGSFGMVYEGVAKGV
VKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMEL
MTRGDLKSYLRSLRPETENNPVLAPPSLSKMIQMSGEIADGMAYLNANKFVHRDLAARNC
MVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVV
LWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMGMCWQYNPKMRPSFLE
IISSIKDEMEPGFREVSFYYSEENKPPEPEELDLEPENMESVPLDPSASSASLPLPDRRS
GHKAENSPGPGVLVLRASFDERQPFAHMNGGRKNERALPLPQSSTC
NT seq 4101 nt   +upstreamnt  +downstreamnt
atgaagtctagctccggaggagggtccccgacctcgctgtggggactgctgtttctctcc
accgtgctcgtgctctggccgacgagtggagaaatctgtgggccaggcatcgatatccgc
aacgacttccatcagctgaagcgcctggagaactgcacggtgatcgagggttacctgcat
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcacggtc
atcactgagtacttgctgctgttccgagtggttggcctcgagagcctcggagacctcttc
cccaacctcacggtcattcgcggctggaaactcttctacaactacgccctagtcatcttc
gagatgaccagtctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgctgacctctgttacctctccactgtggactggtccctgatc
ctggatgcagtgtccaataactacatcgtgggcaataagcccccaaaggaatgtggggat
gtgtgtccaggggccatggaggagaacccaatgtgtgagaagaccgccatcaacaacgag
tacaacttccgctgctggaccacaaaccgctgccagaaaatgtgtccgagcgcgtgtggg
aagcgggcgtgcaccgacaacaacgagtgctgtcaccctgagtgcctgggcagctgcagt
gcgcctgacaacgatacagcctgtgtggcttgcctccactactaccacgccggtatctgt
gtgcccacctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtcag
ttctgtgccagcatcgtcagctctgagaactcggagaacaacaagtttgtgatccatgac
ggcgagtgcatgcaggattgcccctcgggcttcatccgcgacactacccatagcatgcag
tgcatcccttgtaaaggtccttgccccaaggtctgtgatgaacagatggcaaagtccatt
gattctgttacttccgctcagatgcttcaaggatgcaccatcttcaagggcaatttgctc
attaacatccgacgagggaataacattgcttcagaattggagaacttcatggggctcatc
gaggtggtgacgggctacgtgaagatccgccattcccatgccttggtctccttgtccttc
ctaaaaaaccttcgcctcatcttaggagaggaccagctagaagggaattactccttctat
gtcctcgacaaccagaatttgcagcaactatgggactgggaccaccacaacctgaccatc
cgttcggggaagatgtacttcgctttcaatccgaaattatgtgtttctgaaatttaccgc
atggaagaagtgacggggactaaagggcgccaaaacaaaggggacataaacaccaggaac
aatggagagagagcctcctgtgaaagtgatgtcctgcatttcacctccaccacaacgtgg
aagaatcgcgtcatcataacctggcaccggtaccggccccccgactacagggatctcatc
agtttcaccgtcttctacaaggaagcaccctttaagaatgtcacggagtatgatgggcag
gacgcctgtggctccaacagctggaacatggtggatgtggacctcccccagaacaaggac
gtggagcccggtgtcttactgcatgggctgaagccctggactcagtacgctgtttacgtc
aaggctgtaaccctcaccatggtggagaacgaccatatccgtggggccaagagtgagatc
ttgtacattcgcaccaatgcttcagttccttccattcccctggatgtgctctcggcgtcc
aactcctcttctcagttaattgttaagtggaacccgccctctctgcccaacggcaacctg
agctactacatcgtgcgctggcagcagcagcctcaggacggctacctttaccggcacaat
tactgctccaaagacaaaatccccatcaggaagtacgctggcggctccattgacgttgag
gaggtcacagagaaccccaagactgaggtgtgtggcacagagaaagggccttgctgtgcc
tgccccaaaaccgaagccgagaagcaggcggagaaggaggaggccgagtaccgcaaggtc
tttgagaatttcctgcacaactccatcttcgtgcccagacctgacaggaagcggagagat
gtcatccaggtagccaacagcagcacgtccagccgaagcaggaacaccacggccgttgac
acctacaacatcacagacctggacgagctcgagacggagtaccccttctttgagagcaga
gtggataacagggagagaactgtcatttctaaccttcggcctttcacactgtaccgcatc
gatatccacagctgcaaccacgaggctgagaggctgggctgcagcgcctccaactttgtc
tttgcaaggactatgcctgcagacggagcagatgatattcctgggccagtgacctgggag
ccaaggcctgaaaactccatctttttaaagtggccggaacctgagaatcccaatggattg
natctaatgtatgaaataaagtacggagcacaagttgaggatcagcgggaatgtgtgtcc
agacaggactacaggaagtacggaggggccaagctaaaccggctaaacccggggaactac
acagcccggattcaggccacgtctctctctgggaatgggtcgtggacagagcctgtgttc
ttctatgtccaggccaaaacgggatacgaaaacttcatccatctgatcatcgctctgccc
atcgccgtcctgttgatcgtgggagggttggtgattatgctgtacgtcttccatagaaag
agaagtaacagcaggctggggaatggagtcctgtatgcctctgtgaacccggagtacttc
agcgctgcggatgtgtacattcctgatgagtgggaggtggctcgggagaagatcaccatg
agccgggagcttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggtgtg
gtgaaagatgaacccgaaaccagagtggccattaaaacggtgaacgaggccgcaagcatg
cgtgagaggatcgagtttctcaacgaggcttctgtgatgaaggagttcaattgtcaccat
gtggtgaggttgctgggcgtggtgtcccagggccagccaacactggtcatcatggaactg
atgacacggggcgatctcaagagttatctccggtctctgaggccagaaacggagaataat
ccggtcctagcacctccaagcctaagcaagatgattcagatgtctggggagattgcagac
ggcatggcatacctcaacgccaacaagttcgtccacagagaccttgccgcccggaactgc
atggttgccgaagatttcacagtcaagattggagattttggtatgacacgagatatctat
gagacagactattaccggaaaggagggaaggggctgctgcctgtgcgctggatgtctccc
gagtccctcaaggatggagtcttcaccactcactcggatgtctggtcctttggggttgtg
ctctgggagattgccacgctggccgagcagccataccagggcttgtccaatgagcaagtc
cttcgcttcgtgatggaaggcggccttctggacaaaccagacaactgccccgacatgctg
tttgaactgatgggcatgtgctggcagtacaaccccaagatgaggccttccttcctggag
atcatcagcagcatcaaagatgagatggagcccggctttagggaggtctccttctactac
agcgaggagaacaagccgcccgagccagaagagctagacctggagccagagaacatggag
agtgtccctctggacccctcagcctcctcggcctccctgccactgcccgacagacgctcc
gggcacaaggctgagaacagccccggtcctggagtgcttgtcctccgcgccagctttgac
gagaggcagcctttcgcacacatgaacgggggccgcaagaacgagcgggccttaccgctg
ccccagtcttcgacctgctga

DBGET integrated database retrieval system