KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408789Help
Entry
100408789         CDS       T03264                                 

Gene name
SMARCC2
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04714  Thermogenesis
cjc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100408789 (SMARCC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100408789 (SMARCC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100408789 (SMARCC2)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100408789 (SMARCC2)
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100408789 (SMARCC2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    100408789 (SMARCC2)
   PBAF complex
    100408789 (SMARCC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM SWIRM-assoc_3 SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6 Chromo BRCT_2
Motif
Other DBs
NCBI-GeneID: 100408789
NCBI-ProteinID: XP_009002214
Ensembl: ENSCJAG00000011483
UniProt: U3DXQ4
LinkDB All DBs
Position
9
AA seq 1152 aa AA seqDB search
MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQ
EEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRN
VEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYP
VPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAK
WILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRK
RSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKT
VNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQ
THHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSG
LVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEKP
TDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGS
RTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVA
SAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTTSDEPE
RIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKE
SEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAA
AVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLA
DRQAFHMEQLKYAEMRARQQHFQQMHQQQQQPPPALPPGSQPIPPTGAAGPPAVHGLAVA
PASVVPAPAGSGAPPGSLGPSEQIGQAGSIAGPQQQQPAGAPQPGAVPPGVPPPGPHGPS
PFPNQQTPPSMMPGAVPGSGHPGVAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPTAP
SPGTVTPVPPPQ
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcggaagaaggacggcggccccaacgtgaagtattatgaggccgcggacacc
gtgacccagttcgacaacgtgcggctgtggctcggcaagaactataagaagtatatacaa
gctgaaccacccaccaacaagtccctgtctagccttgttgtacagttgctacaatttcag
gaagaagtttttggcaaacatgtcagcaatgcaccgctcactaaactgccgataaaatgt
ttcctagatttcaaagctgggggctccttgtgccacattcttgcagctgcctacaaattc
aagagtgaccagggatggcggcgttacgatttccagaatccgtcacgcatggaccgcaat
gtggaaatgtttatgaccattgagaagtccttggtgcagaataattgcttgtctcgacct
aacatttttctgtgcccagaaattgagcccaaactactagggaaattaaaggacattatc
aagagacaccagggaacagtcactgaggataagaacaatgcctcccatgttgtgtatcct
gtcccggggaatctagaagaagaggaatgggtacgaccagtcatgaagagggataagcag
gttcttctgcactggggctactatcctgacagttatgacacatggatcccagcgagtgaa
attgaagcatctgtggaagatgctccaactcctgagaaacctaggaaggttcatgcaaag
tggatcctggacactgacaccttcaatgaatggatgaatgaggaagactatgaagtaaat
gatgacaaaaaccctgtctcccgccgaaagaagatttcagccaagacattgacagatgag
gtgaacagcccagattcagatcgacgggacaagaaggggggaaactataagaagaggaag
cgctccccctctccttcaccaaccccagaagcaaagaagaaaaatgctaagaaaggtccc
tcaacaccttacactaagtcaaagcgtggtcacagagaagaggagcaagaagacctgaca
aaggacatggacgagccctcaccagtccccaatgtagaagaggtgacacttcccaaaaca
gtcaacacaaagaaagactcagagtcagccccagtcaaaggcggcaccatgactgacctg
gatgaacaggaagatgaaagcatggagacgacgggcaaggatgaggatgagaacagtaca
gggaacaagggggagcagaccaagaatccagatctgcatgaggacaacgtgacggaacag
acccaccacatcatcattcccagctatgcagcctggttcgactacaatagcgttcatgcc
attgagcggagggctcttcctgagttcttcaacggcaagaacaagtccaagactccagag
atctacctggcctatcgaaactttatgattgacacttaccgactgaacccccaagagtat
cttacctctactgcctgccgccgaaatctggcaggtgatgtctgtgccatcatgagggtc
catgccttcctagaacaatggggtcttattaactatcaggtggatgctgagagtcgacca
accccaatggggcctccgcctacctctcacttccatgtcttggctgacacaccatcaggg
ctggtgcctctgcagcccaagaccccgcagggccgccaggttgatgctgataccaaggct
gggcgaaagggcaaagagctggatgacctggtgccagagacggctaagggcaagccagag
ctgcagacctctgcttcccaacaaatgctcaactttcccgacaaaggcaaagagaaacca
acagacatgcaaaactttgggctgcgcacagacatgtacacaaaaaagaatgtcccctcc
aagagcaaagctgcagccagtgccactcgtgagtggacagaacaggaaaccctgcttctc
ctggaggcactggaaatgtacaaagatgactggaacaaagtgtccgagcatgtgggaagc
cgcacacaggacgagtgcatcttgcattttcttcgtcttcccattgaagacccatacctg
gaggactcagaggcctccctaggccccctggcctaccaacccatccccttcagtcagtcg
ggcaaccctgttatgagcactgttgccttcctggcctctgtcgtcgatccccgagtcgcc
tctgctgctgcaaagtcagccctagaggagttctccaaaatgaaggaagaggtacccacg
gccttggtggaggctcatgttcggaaagtggaagaagcagccaaagtaacaggcaaggcg
gaccccgcctttggtctggaaagcagtggcattgcaggaaccacctctgatgagcctgag
cggattgaggagagtgggaatgacgaggctcgggtggaaggccaggccacagatgagaag
aaggagcccaaggaaccccgagaaggagggggtgctatagaggaggaagcaaaggagaaa
accagtgaggctcccaagaaggatgaagagaaagggaaagaaggtgacagcgagaaggag
tctgagaagagtgatggagacccaatagttgatcctgagaaggagaaggagccaaaagaa
gggcaggaggaagtgctgaaggaagtggtggagtctgagggggaaaggaagacaaaggtg
gagcgggacattggcgagggcaacctctccaccgccgctgccgccgccctggccgctgcc
gcagtgaaagccaagcacttggctgcagttgaggaaaggaagatcaaatctttggtggcc
ctgctggtggagacccagatgaaaaagttggagatcaaacttcggcactttgaggagctg
gagactatcatggaccgggagcgagaagcactggagtatcagaggcagcagctcctggcc
gacagacaagccttccacatggagcagctgaagtatgcggagatgagggcccggcagcag
cacttccaacagatgcatcaacagcagcagcagccaccgccagccctacccccaggctcc
cagcctatccccccaacgggggctgctgggccacccgcagtccatggcttggctgtggct
ccagcctctgtagtccctgctcctgctggcagtggggcccctccaggaagcttgggccct
tctgaacagattgggcaggcagggtcaattgcagggccacagcagcagcaaccagctgga
gccccccagcctggggcagtcccaccaggggttcccccccctggaccccatggcccctca
ccgttccccaaccaacaaactcctccctcaatgatgccaggggcagtgccaggcagcggg
cacccaggcgtggcggcccaaagccctgccattgtggcagctgttcagggcaacctcctg
cccagtgccagcccactgccagacccaggcacccccctgcctccagaccccacagccccg
agcccaggcacggtcacccctgtgccacctccacagtga

DBGET integrated database retrieval system