KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409032
Entry
100409032         CDS       T03264                                 

Definition
(RefSeq) cytochrome P450 4A11
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00071  Fatty acid degradation
cjc00590  Arachidonic acid metabolism
cjc00830  Retinol metabolism
cjc01100  Metabolic pathways
cjc03320  PPAR signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100409032
   00590 Arachidonic acid metabolism
    100409032
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100409032
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100409032
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100409032
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100409032
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cjc00199]
    100409032
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     100409032
Cytochrome P450 [BR:cjc00199]
 Cytochrome P450, animal type
  CYP4 family
   100409032
SSDB
Motif
Pfam: p450 Proton_antipo_M
Other DBs
NCBI-GeneID: 100409032
NCBI-ProteinID: XP_003733483
Ensembl: ENSCJAG00000021178
LinkDB
Position
7
AA seq 513 aa
MSVSVLSPSRLLGDVSRILQLTSLLILLLLLIKVAQFYLHRQWLLKVLQEFPCPPSHWLF
GHNKEYSQDQELQRIRKWVEIFPSACPYWLWGSKARVQLYDPDYIKVVLGRSDPKSYGSY
RFLAPWIGHGLLLLNGQTWFQHRRMLTPAFHYDILKPYVEFMADSVRVMLDKWEELIGQD
SPLEIFQHVSLMTLDTIMKCAFSHQGSIQLDRDSQSYIQAVTDLNNLFYFRVRNAFYQND
TIYSLTTAGRWSHRACQLAHQHTDRVIQQRKALLQEQGELEKVRKKRHLDFLDILLLAKM
ENGNSLSDKDLRAEVDTFMFEGHDTTASGISWVLYALATHSKHQQRCREEIQGLLGDGAS
ITWHHLDKMPYTTMCIKEALRLYPPVPGIGRELSTPITFPDGRSLPKGISIILSIYGLHH
NPKVWPNPEVFDPSRFAPGSAQHSHAFLPFSGGARNCIGKQFAMNELKVAVALTLLRFEL
LPDPTRIPIPTPRIVLKSENGIHLHLRRLPNPC
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgagtgtctctgtgctgagccctagcagactcctgggtgatgtctccaggatcctccaa
ttgacctccctgctaatactgcttctgctgctgatcaaggtagcccagttctacctgcac
aggcagtggctgctcaaagtcctccaggagttcccgtgccctccctcccactggctcttt
ggacacaacaaggagtattcacaggaccaggagctacaacggattcggaaatgggtggag
atattcccaagtgcctgtccttattggctatggggaagcaaagctcgtgtccagctctat
gaccctgattatataaaggtggttctggggagatcagacccaaaatcttatggttcctac
agattcctggctccatggattgggcacggcttgctcctgttgaatggccagacatggttc
cagcatcgacggatgctgaccccagccttccactatgacatcctgaagccctacgtggag
ttcatggcagactctgtgagagtgatgctggacaaatgggaagagctcattggccaggac
tcccctctggagatctttcagcatgtctccttgatgaccctggacaccatcatgaagtgt
gccttcagccaccagggcagcattcagttggacagggattctcagtcctatatccaggcc
gttacagacctgaacaacctgttttatttccgtgtgaggaatgccttttaccagaatgac
accatctacagcctgaccactgctggccgctggtcacaccgtgcctgccagctcgcacat
cagcatacagaccgagtgatccaacagaggaaagctctcctgcaggagcagggggagctg
gagaaggtcaggaagaagaggcacttggatttcctggacatcctcctcttggccaaaatg
gagaatgggaacagcttgtcagacaaggatctccgtgctgaggtggacacgttcatgttc
gagggccatgataccacagccagtgggatctcctgggtcctctatgctctggccacacac
tccaagcatcagcagaggtgccgagaggagatccagggcctcttgggggatggagcctcc
atcacctggcaccacctggacaagatgccctataccaccatgtgcatcaaggaggcactg
agactctacccaccagtgccaggcattggcagagagctcagcactcccatcaccttccct
gatgggcgctccttgcccaaaggtatcagcatcatactttccatttatggccttcaccac
aaccccaaagtgtggcccaacccagaggtgtttgacccttcccgttttgcaccaggttct
gctcaacacagccacgctttcctgcccttctcaggaggagcaaggaactgcattgggaaa
caatttgccatgaatgagctgaaggtggccgtggccctgacgctgctccgctttgagctg
ctgcctgatcccaccaggatccctatccccacaccacgaattgtgttgaaatccgaaaat
ggaatccacctgcatctcaggaggctccctaatccttgttag

DBGET integrated database retrieval system