KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409186
Entry
100409186         CDS       T03264                                 

Gene name
GNRH1
Definition
(RefSeq) gonadotropin releasing hormone 1
  KO
K05252  gonadotropin-releasing hormone
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04912  GnRH signaling pathway
cjc04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100409186 (GNRH1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100409186 (GNRH1)
   04912 GnRH signaling pathway
    100409186 (GNRH1)
SSDB
Motif
Pfam: GnRH
Other DBs
NCBI-GeneID: 100409186
NCBI-ProteinID: XP_017819169
Ensembl: ENSCJAG00000019984
UniProt: U3CDM8
LinkDB
Position
13
AA seq 96 aa
MCLRMELIPKLLAGLTLLTVCVAGCSSQHWSYGLRPGGKRDAENFIDSFQEIVKEVGQLE
ETQHFECTVHQPRFPLRDLKGALESLIEEETGQKKI
NT seq 291 nt   +upstreamnt  +downstreamnt
atgtgccttagaatggagctgattccaaaactcctagctggccttactctgctgactgtg
tgtgtggcgggctgctccagccagcactggtcctatggactgcgccctggaggaaagaga
gatgctgaaaattttattgattctttccaagagatagtcaaagaggttggtcaactggaa
gaaacccaacacttcgaatgcaccgtgcaccagccacgttttcccctacgggacctgaaa
ggagctctggaaagtctgattgaagaggaaactgggcagaagaagatttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103792807
Entry
103792807         CDS       T03264                                 

Gene name
GNRH2
Definition
(RefSeq) gonadotropin releasing hormone 2
  KO
K05252  gonadotropin-releasing hormone
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04912  GnRH signaling pathway
cjc04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103792807 (GNRH2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    103792807 (GNRH2)
   04912 GnRH signaling pathway
    103792807 (GNRH2)
SSDB
Motif
Pfam: GnRH
Other DBs
NCBI-GeneID: 103792807
NCBI-ProteinID: XP_008993901
Ensembl: ENSCJAG00000021086
LinkDB
Position
5
AA seq 117 aa
MPAMASSRQGLLLLLVLLTAHPGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPAGSPA
QSAHGLSSDALALLEDSMPWEGRNTAWWSLRQKQHLAQTLLTAAREPRPAPPSSNKV
NT seq 354 nt   +upstreamnt  +downstreamnt
atgcctgccatggccagctccaggcaaggcctcctcctgctcctggtgctgttgactgcg
catcctggaccctcagaggctcagcactggtcccatggctggtaccctggaggaaagcga
gccctcagctcagcccaggatccccagaatgcccttaggcccccagcaggcagcccagcc
cagtctgcccatggcctctcaagtgatgccctggctctcctggaagacagcatgccctgg
gagggcaggaacacagcctggtggtcccttcgccagaagcaacacctggcacagacacta
ctgacagcagcccgagagccccgccccgccccgccgtcctccaataaagtgtga

DBGET integrated database retrieval system