KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409351Help
Entry
100409351         CDS       T03264                                 

Gene name
BRD4
Definition
(RefSeq) bromodomain-containing protein 4
  KO
K11722  bromodomain-containing protein 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100409351 (BRD4)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100409351 (BRD4)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100409351 (BRD4)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  BRD family [OT]
   100409351 (BRD4)
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Brd4/P-TEFb complex
     100409351 (BRD4)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    100409351 (BRD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain BET
Motif
Other DBs
NCBI-GeneID: 100409351
NCBI-ProteinID: XP_017822902
LinkDB All DBs
Position
22
AA seq 743 aa AA seqDB search
MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKEAGTAKPGVSTIPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT
VVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI
DPIHEPPSLPPEPKTTKLGPRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI
LKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEREEPAVAVSSPAVPPPTKVV
APPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE
KDKKEKKKEKHKKKEEVEENKKSKAKEPPPKKTKKNNSSNSSASKKEPAPMKSKPPPTYE
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK
PSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETG
PQMLRLAQRRGEGGGSHGAQEAW
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagagagcggccctgggacgagattgagaaatctgccagtaatgggggatgga
ctagaaacttcccaaatgtctacaacgcaggcccaggcccaaccccagccagccaatgca
gccagcaccaaccccccgcccccagagacctccaaccctaacaagcccaagaggcagacc
aaccagctgcaatacctgctcagagtggtgctcaagacactatggaaacaccagtttgcg
tggcctttccagcagcctgtggatgccgtcaagctgaacctccctgattactataagatc
attaaaacacctatggatatgggaacaataaagaagcgcttggaaaacaactactattgg
aatgctcaggaatgtatccaggacttcaacactatgtttacaaattgttacatatacaac
aagcctggagatgacatagtcttaatggcagaagctctggagaagctcttcttgcaaaaa
ataaacgaactacccacagaagaaactgagatcatgatagtacaggcaaaaggaagagga
cgtgggaggaaagaagcagggacagcaaaacctggcgtttccacaataccaaacacaact
caagcatcaactcctccgcagacccagacccctcagccgaatcctcctcctgtacaggcc
acacctcaccccttccctgctgtcaccccagacctcatcgtccagacccctgtcatgacg
gtggtgcctccccagccactgcagacgcccccgccggtgccccctcagccacaaccccca
cctgctccagctccccagcctgtacagagccacccacccatcatcgcggctaccccgcag
cctgtaaagacaaagaagggagtgaagaggaaagcagacaccaccacccctaccaccatt
gaccccattcacgagccaccctcactacccccggagcctaagaccaccaaactgggcccg
aggcgggagagcagccgtcctgtgaaacctccaaagaaggatgtccccgactctcagcag
catccagcaccagagaagagcagcaaggtctcagagcagctcaagtgctgcagcggcatc
ctcaaggagatgtttgctaagaagcatgccgcctatgcctggcccttctacaagcctgtg
gacgtggaggcgctgggcttgcacgactactgtgacattatcaagcaccccatggacatg
agcacaatcaagtctaaactggaggcccgtgagtaccgtgatgctcaggagtttggtgct
gacgtccgattgatgttctccaactgctataaatacaatcctcccgatcatgaggtggtg
gctatggcccgcaagctccaggatgtgttcgaaatgcgctttgccaagatgccagatgag
cgtgaggagccagcggtggctgtgtcatccccggcagtgccccctcccaccaaggttgtg
gccccaccctcatccagcgacagcagcagcgatagctcctcagacagtgacagttcaact
gatgactctgaggaggagcgagctcagcggctggctgagctccaggagcagctcaaagcc
gtgcacgagcagcttgcagccctctctcagccccagcagaacaaaccaaagaaaaaggag
aaagacaagaaggaaaagaaaaaagaaaagcacaaaaagaaagaggaagtagaggagaat
aaaaagagtaaagccaaggaacctcctcccaaaaagacaaagaaaaataatagcagcaac
agcagtgcgagcaagaaggagccagcgcccatgaagagcaagccccctcccacatatgag
tcagaggaagaggacaagtgcaagcctatgtcctatgaggagaagcggcagctcagcctg
gacatcaacaagctccccggagagaagctgggccgagtggtgcacatcatccagtcacgg
gagccctcgctgaagaactccaaccctgatgagatcgagatcgactttgagaccctgaag
ccatccacactgcgtgagctcgagcgctatgtcacctcctgtttgcggaagaaaaggaaa
cctcaagctgagaaagttgatgtgattgccggctcctccaagatgaagggcttctcatcc
tcagagtcggagagctccagtgagtccagctcctctgacagcgaagactccgaaacaggg
ccacagatgctcaggctggcccagaggagaggagagggaggaggaagccatggtgcccag
gaggcctggtga

DBGET integrated database retrieval system