KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409658
Entry
100409658         CDS       T03264                                 

Gene name
NRG1
Definition
(RefSeq) neuregulin 1
  KO
K05455  neuregulin 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04012  ErbB signaling pathway
cjc05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100409658 (NRG1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100409658 (NRG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100409658 (NRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100409658 (NRG1)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100409658 (NRG1)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100409658 (NRG1)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100409658 (NRG1)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set EGF EGF_2 Ig_4 BiPBP_C DUF973 Cyt_b-c1_8
Other DBs
NCBI-GeneID: 100409658
NCBI-ProteinID: XP_002807532
Ensembl: ENSCJAG00000007626
LinkDB
Position
13
AA seq 645 aa
MSERKEGRGKGKGQKKERGSGKKSEPAAGTPSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSASANITIVDSNEIITGMPASTEEAYVSSESPIRISVSTEGTNTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEA
EELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNIANG
PHHPNPPPENVQLVNQYVSKNVISSEQIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSW
SNGHTESILSESHSVIMMSSVENSRHSSPTGGPRGRLNGIGGPRECNSFLRHARETPDSY
RDSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFVEEE
RPLLLVTPPRLREKKFDHHPQQFSSFHHNPVHDSNSLPPSPLRIVEDEEYETTQEYEPVQ
EPVKKLANSRRAKRTKPNGHIASRLEVDSNTSSQSSNSESETEDERVGEDTPFLGIQNPL
AASLEATPAFRLADSRTNPAGRFSTQEEIQARLSSVIANQDPIAV
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgtccgagcgcaaagaaggcagaggcaaggggaagggccagaagaaggagcgaggctcc
ggcaagaagtccgagcccgcggctgggaccccgagcccagccttgcctccccgattgaaa
gagatgaaaagccaggagtcggctgcagggtccaaactagtccttcggtgtgaaaccagt
tctgaatactcctctctcagattcaagtggttcaaaaatggtaatgaattgaatcgaaaa
aacaaaccacaaaacatcaagatacaaaaaaagccagggaagtcagaactccgcatcaac
aaagcgtcactggctgattctggagagtatatgtgcaaagtgatcagcaaattaggaaat
gacagtgcctctgccaatatcaccatcgtggattcaaatgagatcatcactggcatgcca
gcctcaactgaagaagcatatgtgtcttcagagtctcccattagaatatcagtatcgaca
gaaggaacaaatacttcttcatctacgtctacatctactactgggacaagccatcttgta
aaatgtgcagagaaggagaaaacgttctgtgtgaatggaggcgaatgcttcatggtgaaa
gatctttcaaacccctcgagatacttgtgcaagtgcccaaatgagtttactggtgatcgc
tgccaaaactacgtaatggccagcttctacaagcatcttgggattgaatttatggaggcg
gaggagctctaccagaagagagtgctgaccataaccggcatctgcatcgccctccttgtg
gtcggcatcatgtgtgtggtggcctactgcaaaaccaagaaacagcgaaaaaagcttcat
gaccgtcttcggcagagccttcggtctgaacgaaacaacatgatgaacattgccaatgga
cctcaccatcccaacccaccccccgagaacgtccagctggtgaatcaatacgtatctaaa
aacgtcatctctagtgagcagattgttgagagggaagcagagacatccttttccaccagt
cactatacttccacagcccatcactccactactgtcacccagactcctagccacagctgg
agcaacggacacactgaaagcatcctttcggaaagccactctgtaatcatgatgtcatcc
gtagaaaatagtaggcacagcagcccaactgggggcccaagaggacgtcttaatggcata
ggaggccctcgtgaatgtaacagcttcctcaggcatgccagagaaacccctgattcctac
cgagactctcctcatagtgaaaggtatgtgtcagccatgaccaccccggctcgtatgtca
cctgtagatttccacacgccaagctcccccaaatcacccccttcggaaatgtctccaccc
gtgtccagcatgacggtgtccatgccttccatggcggtcagccccttcgtggaagaagag
agacctctacttcttgtgacaccaccgaggctgcgggagaagaagtttgaccatcaccct
cagcagttcagctccttccaccacaaccccgtgcatgacagtaacagcctcccccctagc
cccttgaggatagtggaggatgaggagtatgaaacgacccaggagtacgagccagtccaa
gagcctgttaagaaactcgccaatagccggcgggccaaaagaaccaagcccaatggccac
attgctagcagattggaagtggacagcaacacaagctcccagagcagtaactcagagagt
gaaacagaagatgaaagagtaggtgaagacacacctttcctgggcatacagaaccccctg
gcagccagtcttgaggcaacacctgccttccgcctggctgacagcaggactaacccagca
ggccgcttctcgacacaggaagaaatccaggccaggctgtctagtgtaattgctaaccaa
gaccctattgctgtataa

DBGET integrated database retrieval system