KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409750Help
Entry
100409750         CDS       T03264                                 

Gene name
ELOVL1
Definition
(RefSeq) ELOVL fatty acid elongase 1
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00062  Fatty acid elongation
cjc01040  Biosynthesis of unsaturated fatty acids
cjc01100  Metabolic pathways
cjc01212  Fatty acid metabolism
Module
cjc_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100409750 (ELOVL1)
   01040 Biosynthesis of unsaturated fatty acids
    100409750 (ELOVL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cjc01004]
    100409750 (ELOVL1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     100409750 (ELOVL1)
Lipid biosynthesis proteins [BR:cjc01004]
 Elongase
  PUFA
   100409750 (ELOVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 100409750
NCBI-ProteinID: XP_002750759
Ensembl: ENSCJAG00000003469
UniProt: F7ER80
LinkDB All DBs
Position
7
AA seq 279 aa AA seqDB search
MEAVVNLYQEMMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRG
FMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFI
ELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVIMYL
YYGLSALGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYG
TIFFVLFSNFWYHSYTKGKRLPRALQQNGAPDLAKVKAN
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgtcgtgaacttgtaccaggagatgatgaagcatgcagatccccggatccag
ggctaccctctgatggggtccccgctgctaatgacctccatcctcctgacctacgtgtac
ttcgttctctcacttgggcctcgcatcatggctaatcggaagcccttccaactccgtggc
ttcatgattgtctacaatttctcactggtggcactctccctctacattgtctatgagttc
ctgatgtcgggctggctgagcacctatacctggcgctgtgatcctgtggactattccaac
agccctgaggcacttaggatggttcgggtggcctggctcttcctcttctccaagttcatt
gaactgatggacacagtgatctttattctccgaaagaaagacgggcaggtgaccttccta
catgtcttccatcactctgtgcttccctggagctggtggtgggggataaagattgccccg
ggaggaatgggctctttccatgccatgataaactcttctgtgcatgtcataatgtacctg
tactacggattgtctgctcttggccctgtggctcaaccctacctttggtggaaaaagcat
atgacagccatccagctgatccagtttgtcctggtctcactgcacatctcccagtactac
tttatgtccagctgtaactaccagtacccagtcataattcaccttatctggatgtatggc
accatcttctttgtgttgttctccaacttctggtatcactcttataccaagggcaagcgg
ctgccccgtgcacttcagcaaaatggagctccagatcttgccaaggtcaaggccaactga

DBGET integrated database retrieval system