KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410032Help
Entry
100410032         CDS       T03264                                 

Definition
(RefSeq) large proline-rich protein BAG6-like
  KO
K23390  large proline-rich protein BAG6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100410032
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic type
  Check point factors
   BAG6-UBL4A-GET4 complex
    100410032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAG6 ubiquitin Rad60-SLD_2 Rad60-SLD TBK1_ULD DUF2407 DUF2939
Motif
Other DBs
NCBI-GeneID: 100410032
NCBI-ProteinID: XP_008978963
LinkDB All DBs
Position
14
AA seq 1071 aa AA seqDB search
MNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPS
GASSGTGSASATHGGGPPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQA
PIQSEPQIRLMMAQHMIRDIQTLLSRMECRGDSQPQHSRPPPQPPIVTLEPVALSSQTSE
PAESEASPREPLEAEVEERAPAQNPELTPAGPAPAGPTPAPETNVPNHPSPAEYVELLQE
LQRLESRLQPFLQCYYEVLGAAATADYNNNHEGREEDQRLINLVGESLRLLGNTFVALSD
LRCNLASVPPRHLHVVRPMSHYTTSMVLQQAAIPIEINMGTTVTMTGNGTRSPPTPNAEA
PPPGPGQASSVAPSSTNVESSTEGAAPPATSHPRVIRISHQSVEPVVMTHMNIQDSDMQP
GGVSSAPTSSLGPPGHGQTLGQQVPGFPTAPQARPSHPGGPPVSGTLQGAGLGTNASLAQ
MVSGLVGQLLMQPVPVAQGTSGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTQP
SMADLQFSQLLGNLLGPAGPGAGGPGVASPTITVAMPGIRAFLQGMTDFLQATHTAPPPP
PPPPPPPPAPEQXTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSSLLGSLGAWT
GSSESIAAFIQHLSGSSNIFDPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQR
LQPQLRSFFHQHYLGGQEPTSSNIWMATHTLITGLEEYVPESFSLVQVQPGVDIIQTNLE
VLQEQFNSIAAHVLHCTDSGFGARLLELGNQGLFKCLALNLHCLGGQQMELAAVINGRIR
RMSRGVNPSLVSWLTTMMGLRLQVVLERMPVGPDAILRYVRRVDDPPXPLPEEPMEVQGA
ERASPEPQWENASPVPGTTAEXWSRGPPPTPEGGSRDEQDGTSAETKPWAAALPPEWVPI
IQQDIQSQRKVKPQSPLSDTYLSGMPAKRCKTMQGEGLQLLLSEAVSQAAKAARARPLIS
PESLSQDLEAPEVQESYRQQLRSDIQKQLQEDPNYSPQHFPNAHRAFADDP
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaaagagtttaaggagcacattgctgcctctgtcagcatcccatctgaaaaa
caacggctcatttaccagggacgagttctgcaagatgataagaagctccaggaatataat
gttgggggaaaggttatccacctggtggaacgggctcctcctcagactcagctcccttct
ggggcatcttctgggacggggtctgcctcagccactcatggtgggggacccccgcctggt
actcgggggcctggggcctctgttcatgaccggaatgccaacagctatgtcatggttgga
accttcaatcttcctagtgacggctcggctgtggatgttcacatcaacatggaacaggcc
ccaattcagagtgagccccagatacgtctgatgatggctcagcacatgatcagggatata
cagaccctactatcccggatggagtgtcgaggggattcccaaccgcagcacagccggcca
cccccgcagccaccaattgtgaccctggagccagtagccttgagctctcaaacatcagaa
ccggctgaaagcgaagcatctcctcgagaacctttggaggcagaagtggaggagcgtgcc
ccagcccaaaacccagagctcactcctgctggcccagccccagcgggcccaacacctgcc
ccagagacaaatgtacccaaccatccttcccctgcggagtatgtcgagctgctccaggag
ctgcagcggctggagagccgcctccagcccttcttgcagtgctactacgaggttctaggt
gctgctgccaccgcagactacaataacaatcacgagggccgggaggaggatcagcggttg
atcaacttggttggggagagcctgcgattgctgggcaacacctttgtggcactgtctgac
ctgcgctgtaatctggcctctgtgcccccacgacacctgcatgtggtccgccctatgtct
cactataccacctccatggtgctccagcaggcagccattcccatagagatcaacatggga
accactgtaaccatgacaggaaatgggactcggtccccaccaactcccaatgcagaggca
cctccccctggtcctgggcaggcctcgtctgtggctccgtcttctaccaatgttgagtcc
tcaactgagggggctgccccgccagccaccagccatccaagggtcatccggatttcccac
cagagtgtggaaccggtggtcatgacacacatgaacattcaagattctgacatgcagcct
ggtggtgtttcgagtgctcccactagctccttgggaccccctggtcatggccaaaccttg
ggacagcaggtgccaggctttccaacagctccacaggctcggccttcccatcctggaggg
cccccagtctctgggactctgcagggtgctgggctgggtaccaatgcctcattggcccag
atggtgagcggcctcgtggggcagcttcttatgcagcctgtccctgttgctcaggggacc
tcaggaatggctccaccaccagcccctgccactgcttctgccagtgctggcaccaccaac
acagctaccacagctggccctgcccctggggggcctgcccagcctccacccacccaaccc
tccatggcagatcttcagttctctcagcttctggggaatctgctagggcccgcagggcca
ggggctggagggcctggtgtggcttctcccaccatcactgtggcgatgcctggtatccgt
gcctttctccagggcatgactgacttcttgcaggcaacacatacagcccctccacccccg
ccacctcctccacccccaccacctgccccagaacagtagaccatgcccccaccaggctcc
ccttccggtggtgcagggagtcctggaggcctgggtctcgagagcctgtcaccagagttt
tttacctcagtggtgcagggtgtgctgagctccctacttggctccttgggggcttggact
ggcagcagtgaaagtattgctgccttcatacaacacctcagtggatccagcaacatcttt
gatcctggagctgatggggcccttggattctttggggccctgctgtctcttctgtgtcag
aacttctctatggtggacgtagtaatgctcctccatgggcatttccagccactacaacgg
ctccagccccagctgcgatccttcttccaccagcactacctgggtggtcaggagcccaca
tccagtaacatctggatggcaacccacacattgatcacagggctagaagaatatgtgccg
gagagtttttctttggtgcaggtgcagccaggtgtggacatcatccagacaaacttggaa
gttctccaagagcagtttaatagcattgctgctcatgtgctgcactgcacagatagtgga
tttggggcccggttgctggagttgggtaaccaaggcctgtttaaatgcctggccctgaat
ctgcattgcttgggaggccagcagatggagcttgctgctgttatcaatggccgaattcgt
cgtatgtctcgtggggtgaatccctccttggtgagctggctgaccactatgatgggactg
aggcttcaggtggtactggagcgcatgcccgtaggccctgatgccattctcagatacgtt
cgcagagttgatgatccccccnagccacttcctgaggagccaatggaagttcagggagca
gaaagagcttcccctgagcctcagtgggagaatgcttccccagtccctggaacaacagca
gaanngtggtcccgaggtccacctcctactcctgaggggggctcccgagatgaacaggat
ggaacttcagctgagacaaaaccttgggcagctgcactccccccagaatgggtccctatt
atccaacaggatattcagagccagcggaaggtgaaaccgcagtcccctctgagtgatacc
tacctcagtggtatgcctgccaagagatgcaagacgatgcagggtgagggcctccagctg
cttctctcagaggctgtgagccaggcagctaaggcagccagagctcggcccctgattagc
cccgagagcctgagccaggacctggaggcaccagaggttcaggagagctacaggcagcag
ctccggtctgatatacaaaaacaactgcaggaagaccccaactatagtccccagcacttc
cccaatgcccaccgggcctttgctgatgatccttag

DBGET integrated database retrieval system