KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410185Help
Entry
100410185         CDS       T03264                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04146  Peroxisome
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100410185 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100410185 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100410185 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100410185 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    100410185 (SOD2)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100410185 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100410185
NCBI-ProteinID: NP_001254675
Ensembl: ENSCJAG00000011664
UniProt: Q8HXP0
LinkDB All DBs
Position
4
AA seq 199 aa AA seqDB search
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNDTEEKYKEALAKGDVTAQIA
LQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKERLTAASVGVQ
GSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKA
IWNVINWENVTERYMACKK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacagcctccccgacctgccctacgactacggcgccctggagcctcacatcaac
gcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaacaacctgaac
gacaccgaagagaagtacaaggaggcgctggccaagggagatgttacagcccagatagct
cttcagcctgcgctgaagttcaacggtggcggtcatatcaatcatagcattttctggaca
aacctcagccctaacggtggtggagaacccaaaggggagttgctggaagccatcaaacgt
gactttggttcctttgacaagtttaaggagaggctgacagctgcgtctgttggtgtccaa
ggctcaggttggggttggcttggtttcaataaggaacggggacacttacaaattgctgct
tgtccgaatcaggatcccctgcaaggaacaacaggccttattccactgctggggattgat
gtgtgggagcatgcttattaccttcagtataaaaatgtcagacctgattacctaaaagct
atttggaatgtaatcaactgggagaatgtaactgaaagatacatggcttgcaaaaagtaa

DBGET integrated database retrieval system