KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410194
Entry
100410194         CDS       T03264                                 

Gene name
VAMP2
Definition
(RefSeq) vesicle associated membrane protein 2
  KO
K13504  vesicle-associated membrane protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04130  SNARE interactions in vesicular transport
cjc04721  Synaptic vesicle cycle
cjc04911  Insulin secretion
cjc04962  Vasopressin-regulated water reabsorption
cjc04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    100410194 (VAMP2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100410194 (VAMP2)
  09154 Digestive system
   04970 Salivary secretion
    100410194 (VAMP2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100410194 (VAMP2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100410194 (VAMP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100410194 (VAMP2)
Membrane trafficking [BR:cjc04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    100410194 (VAMP2)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    100410194 (VAMP2)
SSDB
Motif
Pfam: Synaptobrevin MCU PRIMA1 Orf78 MgtE Tweety Ferlin_C DUF2207 DUF2970 CD34_antigen
Other DBs
NCBI-GeneID: 100410194
NCBI-ProteinID: XP_002747981
Ensembl: ENSCJAG00000014540
UniProt: F7IDU8
LinkDB
Position
5
AA seq 116 aa
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
NT seq 351 nt   +upstreamnt  +downstreamnt
atgtctgctactgctgccacggccccccctgccgccccagctggggagggtggcccccct
gcgccccctccaaacctcactagtaacaggagactgcagcagacccaggcccaggtggat
gaggtggtggacatcatgagggtgaacgtggacaaggtcctggagcgagaccagaagcta
tctgagctggatgaccgtgcagacgcgctccaggcaggggcctcccagtttgaaacaagt
gcagccaagctcaagcgcaagtattggtggaaaaacctcaagatgatgatcatcttggga
gtgatttgcgccatcatcctcatcatcatcatagtttacttcagcacttaa

DBGET integrated database retrieval system