KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410210
Entry
100410210         CDS       T03264                                 

Gene name
NLRP4
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100410210 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:cjc04054]
    100410210 (NLRP4)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100410210 (NLRP4)
Pattern recognition receptors [BR:cjc04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100410210 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 ResIII VirE AAA_28 AAA_14 Med12
Other DBs
NCBI-GeneID: 100410210
NCBI-ProteinID: XP_002763820
LinkDB
Position
22
AA seq 986 aa
MAASFFSDFGLMWYLEELKKEEFRRFKEYLKQLTSHLELKPIPWAEVKKASREELANLLL
KHYEEQQAWNVTLRIFQKMDRKDLCVKVTRERTGYTKTYQDHAKKKFSRLWSSNSVTEIH
QYFHQEVKQEECDHLDRLFASKEPGKHPRTVVIQGAQGIGKTTLLMKLMWAWSDSRVYQD
RFLYAFYFCCRELRELPAVSLADLICREWPDPAAPVTEIVSQPERLLFVIDSFEQLEADV
NQPDSDLCGDWKEKRPVQVVLSSLLRRKMLPEASLLVAVKPTCPKELRERVAISEIYEPR
GFDESDRLVYFCCFFQDPKRAMEAFTLVRESQQLFATCQVPLLCWLLCTALKQEMQKGKD
LALTCQNTTSVYASFIFNLFTPDGAAGPTEDSRRQLKGLCALAAEGMWTDTFEFGDEALR
RHGIADADIPALLGTKVLLKFGERVSSYAFIHVCIQEFCAAMFYLLKSHLDHPHPAVRSV
QELLVNNFQKARRPHWIFLGCFLTGLLNKKEQEKLNAFFGFQLSQEIKQQFEQCLKSLGE
HEDLQEQVDALAIFYCLFEMQEPAFVRQAVNLLQEGSFRIVDSSDLVVSAYCLKYCSSLK
KLSFSIQNVFKKEDTHSPVSDYSLTCWHHICSVFTTSGCLREVQVQDSTLSESAFATWCN
QLRHPSCRLQKLGINNVSFSGQSSQLFEVLFHQPDLKYLSLTLTKLSRDDVKSLCDALNA
PAGSVEELSLVNCELSPGDCEVLAFVLSKNKKLKYLNVSCNRIDEGVRHLCEALSRPDTV
LTYLMLAYCQLSERCWEDFSEMLLRNSSLRHVDLGANVLKDEGLRTLCKALKHPDCRLDS
LCLVKCFITAAGCEDLASALISNQNLKNLEIGCNEIGDVGVELLCGALTHPDCRVEVLGL
EACALTSACCKDLASALTSSKTLQQLNLTLNALDHGGVAVLCEALRHPECALRVLGLKKA
DFGEETQALLMAEEERNPRLMIVDDL
NT seq 2961 nt   +upstreamnt  +downstreamnt
atggcagcctccttcttctccgatttcggccttatgtggtacctggaggagctcaagaag
gaggagttcagaagatttaaggaatatctcaagcaactgacttcgcatcttgaactcaag
ccgattccctgggctgaagtgaagaaggcttcccgggaagaactcgcaaacctcttgctc
aagcactacgaggaacagcaagcttggaacgtgaccttaagaatctttcagaagatggac
agaaaggatctctgtgtgaaggtcacgagagagaggacaggatacacaaagacctatcaa
gatcacgccaagaagaagttcagccgcttatggtccagcaactctgtcactgagattcac
cagtactttcatcaggaagtcaaacaggaggaatgtgaccatttggaccgcctttttgct
tccaaggagcccgggaaacacccacgtacagtggtcattcagggagcgcaaggaatcggg
aagacgacgctcctcatgaagctgatgtgggcctggtcggacagcagggtctaccaggac
aggttcctgtacgccttctacttctgctgccgggaactgagggagctgccggcggtgagc
ttggctgacttgatctgcagagagtggcccgaccccgccgctcccgtgacagagatcgtg
tcccagccggagcgactcctgttcgtcatcgacagcttcgaacagctggaggccgacgtg
aaccagcccgactcggatctgtgcggcgactggaaggaaaagcggccggtgcaggtggtc
ctgagcagtttgctgaggaggaagatgctcccggaggcctccctgctggtcgccgtcaaa
cccacgtgcccgaaggagctccgggagcgggtggcgatctcagaaatatatgagccccgg
ggattcgacgagagcgacaggttggtgtacttctgctgtttctttcaagacccgaagaga
gccatggaggccttcactctcgtgagagaaagtcagcagctgtttgccacgtgccaagtc
ccgctgctctgctggctcctgtgtaccgctctgaagcaagagatgcagaaggggaaagac
ctggccctgacctgccagaacaccacctccgtgtacgcctctttcatcttcaacctgttc
acacccgacggtgccgcggggccgaccgaggacagccggcgccagctgaagggcctgtgc
gccctggctgcggagggcatgtggaccgacacgttcgagtttggagacgaagccctcagg
agacacggcatcgcggatgccgacatccccgcgctgctgggcaccaaggttcttctgaag
ttcggggagcgcgtgagctcctacgcgttcatccacgtgtgtatccaggagttctgtgcc
gccatgttctacctcctcaagagccacctcgaccatcctcacccagctgtcagaagtgtc
caggaattgctagtcaacaactttcaaaaagcgaggagaccacactggattttcttgggg
tgttttctaaccggtcttttaaataaaaaggaacaggaaaaactgaacgcgtttttcggc
ttccagctgtcccaagagataaagcagcaatttgagcagtgcctgaagagcctaggggag
cacgaggatctgcaggagcaggtggatgccttggcgatattttactgtctcttcgagatg
caggagccggcgtttgtgaggcaggccgtgaacctcctccaagaaggcagcttccgtatt
gtcgacagctcagacctggtggtttctgcctactgcttaaagtactgctccagcttgaag
aaactttctttttccatccagaacgtctttaagaaagaggatacgcacagccctgtgtcg
gattacagcctcacctgctggcatcacatctgctctgtgttcactaccagtgggtgcctc
agagaggtccaggtgcaggacagcaccctcagcgagtctgccttcgcgacctggtgtaac
cagctgaggcaccccagctgtcgccttcagaagctcgggataaataatgtttccttttct
ggtcagagcagtcagctctttgaagtgctctttcatcagccggatttgaaatacctgagc
ctcaccctcacgaaactctctcgtgatgacgtgaagtccctctgtgatgcattgaacgcc
ccggcgggcagcgtagaagagctatcgctggtcaactgcgaactctcgccgggggattgt
gaagtcctcgccttcgtcctgagcaagaacaagaagctcaagtatctgaatgtctcctgc
aaccgcatagacgagggcgtgcgccatctgtgtgaagccctgagccgcccggacacggtc
ctcacctacctgatgttggcttactgtcagctcagtgagcggtgctgggaagacttctcg
gaaatgcttctgcgtaacagcagcctgcgccacgtggacctcggcgccaacgtcctgaag
gacgaaggtctgagaaccctctgcaaggccctgaaacacccagactgccgcctcgattcg
ctgtgtctggtaaaatgttttatcactgctgctggctgtgaagacctcgcctcggctctc
atcagtaatcagaacctgaagaatctggagattgggtgcaatgaaataggagacgtgggc
gtggagctgctgtgcggggctctgacgcatccggattgccgcgtggaggttctcgggttg
gaagcctgtgcgttgacaagcgcctgctgtaaggacctcgcgtctgctctcaccagcagt
aagaccctgcagcagctaaacctgaccttgaacgccttggaccacggaggggtggctgtg
ctctgtgaggccctgagacacccagagtgtgccctgagggtgctcgggctgaaaaaagct
gattttggtgaggaaacccaggcacttctgatggctgaggaagagagaaatcccagactg
atgatcgtagacgacctctga

DBGET integrated database retrieval system