KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410231
Entry
100410231         CDS       T03264                                 

Gene name
PTPN6
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 6
  KO
K05697  tyrosine-protein phosphatase non-receptor type 6 [EC:3.1.3.48]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04520  Adherens junction
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc05140  Leishmaniasis
cjc05205  Proteoglycans in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100410231 (PTPN6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100410231 (PTPN6)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100410231 (PTPN6)
   04660 T cell receptor signaling pathway
    100410231 (PTPN6)
   04662 B cell receptor signaling pathway
    100410231 (PTPN6)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100410231 (PTPN6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100410231 (PTPN6)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100410231 (PTPN6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100410231 (PTPN6)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100410231 (PTPN6)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100410231 (PTPN6)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc PTPlike_phytase Y_phosphatase3
Other DBs
NCBI-GeneID: 100410231
NCBI-ProteinID: XP_017831399
Ensembl: ENSCJAG00000007188
LinkDB
Position
9
AA seq 624 aa
MLSRGWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSG
DFYDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGG
QAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTV
GGSETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESED
TAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSSIPG
SDYINANYIKNQLLGPDENTKTYIASQGCLEATVNDFWQMVWQENTRVIVMTTREVEKGR
NKCVPYWPEVGTQRVYGPYSVTNCREHDTPEYKLRSLQVSPLDNGDLVREIWHYQYLSWP
DHGVPSEPGGVLSFLDQINQRQESLPRAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGL
DCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQYIETTKKKLEVLQSQKGQESEYGN
ITYPPAMKNAHAKASRTSSKHKEDVYENLHSKNKREEKVKKQRSADKEKSKGSLKRNLSP
DPAEASHSGQTHNLNLGVPHSIVI
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgctgtcccgtgggtggtttcaccgagacctcagtgggctggatgcagagaccctgctc
aagggccgaggtgtccatggcagcttcctggctcggcccagtcgcaagaaccagggtgac
ttctcgctctctgtcagggtgggggatcaggtgacccatattcggatccagaactcaggg
gatttctacgacctgtatggaggggagaagttcgccacgctgacggagctggtggagtac
tacactcagcagcagggcgtcctgcaggatcgtgacggcaccatcatccacctcaagtac
ccgctgaactgctccgaccccactagtgagaggtggtaccatggccacatgtctggagga
caggcagagacactgcttcaggccaagggcgagccttggacgtttcttgtgcgtgagagt
ctcagccagcctggagactttgtgctgtccgtgctcagtgaccagcccaaggctggccca
ggctccccactcagggtcacccacatcaaggtcatgtgtgagggtggacgctacacggtg
ggtggttcagagacctttgatagcctcacggacctggtggagcatttcaagaagacgggg
attgaggaggcctcaggcgccttcgtctacctgcggcagccgtactacgccacgagggtg
aatgcggccgacattgagaaccgagtcttggaactgaacaagaagcaggagtccgaggac
acagccaaggctggcttctgggaggagtttgagagtctgcagaagcaggaggtgaagaac
ttgcaccagcgcctggaagggcagcggccagagaacaagggcaagaatcgctacaagaac
attcttccctttgaccacagccgagtgatcctgcagggacgtgacagtagcatccctggg
tctgactacatcaatgcaaactacatcaagaaccagctgctaggacctgatgagaacact
aagacctatatcgccagccagggctgtctggaggccacggtcaatgacttctggcagatg
gtgtggcaggagaacacccgcgtcatcgtcatgaccacccgagaggtggagaaaggccgg
aacaaatgtgtcccatactggcccgaggtgggcactcagcgcgtttatgggccctactct
gtgaccaactgcagggagcacgacacgcccgaatacaaactccgcagcttgcaggtctcc
ccactggacaatggggacctggttcgggagatctggcactaccagtacctgagctggcct
gaccatggggtccccagtgagcccgggggcgtcctcagcttcctggaccagatcaaccag
cggcaggaaagtctgcctcgcgcaggacccatcatcgtgcactgcagcgcgggcattggc
cgcacaggtaccatcattgtcatcgacatgctcatggagaacatctccaccaagggcctg
gactgtgacattgacatccagaagactatccagatggtgcgggcgcagcgctcgggcatg
gtgcagacggaggcgcagtacaagttcatctacgtggccattgcccagtacattgaaacc
accaagaagaagctggaggtcctgcagtcgcagaagggccaggagtcggagtatgggaac
atcacctaccccccagccatgaagaacgcccatgccaaggcctcccgcacctcatccaaa
cacaaggaggatgtgtatgagaacctgcacagtaagaacaagcgggaggagaaagtgaag
aagcagcggtcagcagacaaggagaagagcaagggttccctcaagaggaacctcagccca
gaccctgcggaagcctcccacagtggacagacccacaacctgaacctaggagtgccccat
tctattgtaatttaa

DBGET integrated database retrieval system