KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410387
Entry
100410387         CDS       T03264                                 

Gene name
PTCH1
Definition
(RefSeq) patched 1
  KO
K06225  patched 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04340  Hedgehog signaling pathway
cjc04360  Axon guidance
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100410387 (PTCH1)
   04024 cAMP signaling pathway
    100410387 (PTCH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100410387 (PTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410387 (PTCH1)
   05205 Proteoglycans in cancer
    100410387 (PTCH1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100410387 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 100410387
NCBI-ProteinID: XP_017827699
Ensembl: ENSCJAG00000021318
UniProt: U3D5C7
LinkDB
Position
1
AA seq 1449 aa
MASAGNAAEPQDRGGGGGCIGAPGRPAGGGRRRRTGGLRRAAAPDLDYLHRPSYCDAAFA
LEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANL
ETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEDANVLTTEALLQHLDS
ALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKL
QSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPAD
PDCPTTAPNKNSTKPLDTALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLISAHALQ
TMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLS
FTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSV
AAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECL
KRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLY
RREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDSTCYSPPPPYSSHSFAHETQITMQST
VQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLH
CLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIV
PRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLP
KMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQ
LTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRL
RIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICNNYTSLGLSSYPNGYPFLFWEQY
IGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAV
PVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLA
GSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPP
PSVVRFAVPPGPMHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGMGGPAHQVIVEATEN
PVFAHSTVVPPESRHHPRSNPRQQPHLDSGSLPPGQQGQQPRRNPPREGLWPPPYRPRRD
AFEISTEGHSGPSNRDRWGPRGTRSHNPRNPASTAMGSSMPGYCQPITTVTASASVTVAV
HPPPVPGPGRNPRGGLRPGYEGYPETDHGLFEDPHVPFHVRRERRDSKVEVIELQDVECE
ERPRGSSSN
NT seq 4350 nt   +upstreamnt  +downstreamnt
atggcctcggctggtaacgccgccgagccccaggaccgcggcggcggcggcggctgtatc
ggtgctccgggccggccggctggaggcgggaggcgcagacggaccgggggactgcgccgc
gccgccgcgccggacctggactatctgcaccggcccagctactgcgacgccgccttcgct
ctggagcagatttccaaggggaaggctactggccggaaagcgccgctgtggctgagagcg
aagtttcagagactcttatttaaactgggttgttacattcaaaaaaactgcggcaagttc
ttggttgtgggcctcctgatatttggggccttcgcggtgggattaaaggcagcgaacctc
gagaccaacgtagaggagctgtgggtggaagttggaggacgagtaagtcgtgaattaaat
tatactcgccagaagattggagaagaggctatgtttaatcctcaactcatgatacagacc
cctaaagaggaagatgctaatgtcctgaccacagaagcgctcttacaacacctggactcg
gcgctccaggccagccgtgtccacgtatacatgtacaacaggcagtggaaattggaacat
ctgtgttacaaatcaggagagcttatcacagaaacaggttacatggatcagataatagaa
tatctttacccttgtttgattattacacctttggactgcttctgggaaggggcgaaatta
cagtctgggacagcatacctcctaggtaaacctcctttgcggtggacaaacttcgaccct
ttggaattcttagaagagttaaagaaaataaactatcaagtggacagctgggaggaaatg
ctgaataaggctgaggttggtcatggctacatggaccgtccctgcctcaatccggccgat
ccagactgccccaccacagcccccaacaaaaattcaaccaaacctcttgatacggccctt
gttttgaatggtggatgtcatggcttatccagaaagtatatgcactggcaggaggaattg
attgtgggtggcacagtcaagaacagcactggaaagctcatcagcgcccacgccctgcag
accatgttccagttaatgactcccaagcaaatgtacgagcacttcaaggggtacgagtat
gtctcccacatcaactggaatgaggacaaggcagcagccatcctggaggcctggcagagg
acctatgtggaggtggttcatcagagtgtcgcacagaactccactcagaaggtgctttcc
ttcaccaccacaaccctggacgacatcctgaaatcattctctgacgtcagtgtcatccgt
gtggccagtggctacctactcatgctcgcctatgcctgtctaaccatgctgcgctgggac
tgctccaagtcccagggtgccgtggggctggctggcgtcctgctggttgcactgtcagtg
gctgcaggactgggcctgtgctcattgatcggaatttcctttaacgctgcaacaactcag
gttttgccatttctcgctcttggtgttggcgtggatgatgtatttcttctggcccacgcc
ttcagtgaaaccggacagaataaaagaatcccttttgaggacaggaccggggagtgcctg
aagcgcacaggagccagcgtggccctcacatccatcagcaacgtcacagccttcttcatg
gctgcattaatcccgattcccgctctgcgcgcgttctccctccaggcagcggtagtagtg
gtgttcaattttgccatggttctgctcatttttcctgcaattctcagcatggatttatat
cgacgtgaggacaggagactggatattttctgctgttttacaagcccctgcgtcagcaga
gtgattcaggttgaacctcaggcctacactgacacccatgacagtacctgctacagcccc
ccacccccctacagcagccacagctttgcccatgaaacgcagattaccatgcagtccact
gtccagctgcgcacagagtacgacccccacactcacgtgtactacaccaccgctgagcca
cgctccgagatctccgtgcagcccgtcaccgtgacacaggacaccctcagctgccagagc
ccagagagcaccagctccacaagggacctgctctcccagttctctgactccagcctccac
tgccttgagcccccctgtaccaagtggaccctctcatcttttgctgagaagcactatgct
cctttcctcttgaaaccaaaagccaaggtagtggtgatcttcctttttctgggcttgctg
ggggtcagcctttacgggaccacccgagtgagagacgggctggaccttacggacattgta
cctcgggaaaccagagaatatgactttattgctgcacaattcaaatacttttctttctac
aacatgtatatagtcacccagaaagcagactacccgaatatccagcacttactttacgac
cttcacaggagcttcagtaacgtgaagtatgtcatgttggaagaaaacaaacagcttccc
aaaatgtggctgcactacttcagagactggctgcaaggacttcaggatgcatttgacagt
gactgggaaaccgggaaaatcatgccaaacaattacaagaatggatcagacgatggagtc
cttgcctacaaactcctggtgcagaccggcagccgcgataagcccatcgacatcagccag
ttgactaaacagcgtctggtggatgcagatggcatcattaatcccagcgctttctacatc
tacctgacggcttgggtcagcaacgaccccgtcgcgtatgctgcctcccaggccaacatc
cggcctcaccgaccagaatgggtacatgacaaagccgactacatgcccgaaaccaggctg
agaatcccggcagcagagcccatcgagtatgcccagttccctttctacctcaacggcttg
cgagacacctcagactttgtggaggcaattgaaaaagtgaggacgatctgtaacaactac
acgagcctggggctgtccagttaccccaacggctatcccttcctcttctgggagcagtac
atcggcctccgccactggctgctgctgttcatcagcgtggtgttggcctgcacgttcctc
gtgtgcgccgtcttccttctgaacccctggacggccgggatcattgtgatggtcctggcg
ctgatgacggtcgagctcttcggcatgatgggcctcattggaatcaagctcagcgctgtg
cccgtggtcatcctgatcgcctccgttggcataggagtggagttcactgttcacgttgct
ttggcctttctgacggccataggcgacaagaaccgcagggctgtgcttgccctggagcac
atgtttgcacctgtcctggatggcgctgtgtccactctgctgggagtgctcatgcttgcg
ggatctgagtttgacttcattgtcaggtatttcttcgctgtgctggcaatcctcaccatc
ctcggcgttctcaatgggctggttttgcttcccgtgcttttgtctttctttggaccatat
cctgaggtgtctccagccaacggcttgaaccgcctgcccacaccctcacctgagccaccc
cccagtgtggtcaggttcgccgtgccccccggtcccatgcacagcgggtctgattcctcc
gactcggagtatagttcccagacgacagtgtcaggcctcagtgaggagcttcggcactac
gaggcccagcagggcatgggaggccctgcccaccaagtgatcgtggaagccacagaaaac
cccgtctttgcccactctactgtggtccctcccgaatccaggcatcacccacgctcgaac
ccacgacagcaaccccacctggactcagggtccctgcctcctgggcagcaaggccagcag
ccccgcaggaacccccccagagaaggcttgtggccacccccctatagaccgcgcagagac
gcttttgaaatttctactgaagggcattctggccctagcaatagggaccgctggggcccc
cgcgggacccgttctcacaaccctcggaacccagcgtccactgccatgggcagctccatg
cccggctactgccagcccatcaccactgtgacggcttctgcctccgtgactgttgctgtg
cacccgccacctgttcctgggcctgggcggaacccccgaggggggctccgcccaggctac
gaaggctaccctgagactgaccacggcctgttcgaggacccccacgtgcctttccacgtc
cggcgtgaaaggagggattcaaaggtggaagtcattgagctgcaggacgtggagtgtgag
gagaggccccggggaagcagctccaactga

DBGET integrated database retrieval system