KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410496Help
Entry
100410496         CDS       T03264                                 

Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03015  mRNA surveillance pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04114  Oocyte meiosis
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04611  Platelet activation
cjc04720  Long-term potentiation
cjc04728  Dopaminergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04931  Insulin resistance
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05168  Herpes simplex virus 1 infection
cjc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100410496
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100410496
   04024 cAMP signaling pathway
    100410496
   04022 cGMP-PKG signaling pathway
    100410496
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100410496
   04218 Cellular senescence
    100410496
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100410496
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100410496
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100410496
  09152 Endocrine system
   04910 Insulin signaling pathway
    100410496
   04921 Oxytocin signaling pathway
    100410496
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100410496
   04270 Vascular smooth muscle contraction
    100410496
  09156 Nervous system
   04728 Dopaminergic synapse
    100410496
   04720 Long-term potentiation
    100410496
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100410496
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100410496
  09165 Substance dependence
   05031 Amphetamine addiction
    100410496
   05034 Alcoholism
    100410496
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100410496
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100410496
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100410496
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100410496
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100410496
   03041 Spliceosome [BR:cjc03041]
    100410496
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100410496
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100410496
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100410496
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100410496
Spliceosome [BR:cjc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100410496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 100410496
NCBI-ProteinID: XP_009006467
Ensembl: ENSCJAG00000016256
UniProt: F7I9S2
LinkDB All DBs
Position
11
AA seq 337 aa AA seqDB search
MANLDKLNIDSIIQRLLEVRGSKPDKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEFGGFPPESNYLFLGDYVDRGKQSLETICLLMAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIGRIVRPTDVPGQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVENGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDKTLMCSFQILKPAE
KKKPNAMRPVTPPRVTSGLNPSIQKASNYRNSTVLYE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttagataaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctgataagaatgtccagcttcaggagaatgaaatcagaggactgtgccta
aagtctcgtgagatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatgggcaatactatgatttgctgcgactttttgagttcggtggt
ttcccgccagaaagcaactacctgtttcttggggactatgtggacaggggaaagcagtca
ttggagacaatctgcctcttaatggcctacaaaatcaaatatcctgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaacagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattgggcgaattgtgcgaccaactgatgtaccaggtcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaaaatggatatgaattttttgcaaag
aggcagttggttactctgttttctgcacccaattattgtggcgagtttgacaatgcaggt
gccatgatgagtgtggacaaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccaaatgccatgagacctgtaacacctccaagggttacatcaggcctgaac
ccatccattcagaaagcttcaaattatagaaacagtactgttctatatgagtga

DBGET integrated database retrieval system