KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410549
Entry
100410549         CDS       T03264                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100410549 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    100410549 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    100410549 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100410549 (MAVS)
   05160 Hepatitis C
    100410549 (MAVS)
   05171 Coronavirus disease - COVID-19
    100410549 (MAVS)
   05164 Influenza A
    100410549 (MAVS)
   05162 Measles
    100410549 (MAVS)
   05168 Herpes simplex virus 1 infection
    100410549 (MAVS)
   05169 Epstein-Barr virus infection
    100410549 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 100410549
NCBI-ProteinID: XP_008993949
LinkDB
Position
5
AA seq 532 aa
MPFAEDKTYKYICRHFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFN
TIQRRPGWVESFIVALRACELSDLADEVARVYQSYQPRTPEHPPAPLEAPSVSAEVPGPS
TPAAAHSIPYNGYREKEPSYPMPVQESQPPESLEESSEQAPQMLSPGAIPRRPGGGPVEP
SADLAALSPVTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRL
PGPAGSVSTGTFSSSSPGLASAGVEEGDQPEPVICSSGAEAPANSLPSKVPTTLMPVNTV
PPEVPANPASASTVTSKLPPSSKPPGAVPSNVLTNPAPSKLPISSTRAVMVPSKVPSSMV
LTTGNASTVPTSRSSRAEETPAAPTPAGATGGSSAWLDNSSENGGLGSELSKPGMLVSQV
DSLFSGCSEDLAISASSSLGVGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPAD
LEGGPRPHTDQKFQDEEVPCHWSSLGSPWLQAAVAGVLAAILLAVLYQRRQL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgccgtttgctgaagacaaaacctataagtatatctgcagacatttcagcaatttttgc
aatgtggatgttgtagagattctgccttacctgccctgcctcacagcaagagaccaggat
cgactgcgggccacttgcacactctcagggaaccgggacaccctctggcacctattcaat
accattcagcggcgacccggctgggtggagtccttcattgtggccctgagggcctgtgag
ctgtctgatctcgcggatgaagtggcccgtgtctaccagagctaccagcctcggaccccg
gaacatcctccagccccactggaggcaccgtcagtttctgctgaggtaccaggaccctcc
acgcctgctgcagcccacagcatcccctacaatggctacagagagaaggagccaagctac
cccatgcctgtccaggagtcccagccgccagagtccctggaagagagttcagagcaagcc
ccgcagatgctcagtcccggagccatcccaaggaggccgggtggtggccctgtggagccc
tccgctgacctggcagcccttagccctgtgacctccagtgggcatcaggagcaggacaca
gaactgggcagtacccacacagcaggtgcaacctccagcctcacaccatcccgtgggcct
gtgtctccatctgtctccttccagcccctggcccgatccacacccagggcaagccgcttg
cctggacctgcagggtcagtttctactggtaccttctcctcctcatcccctggattggcc
tctgcaggggttgaagagggtgaccagcccgagcctgtcatctgctccagtggggcagag
gcacctgccaactctctgccctccaaagtgcctaccaccttgatgcctgtgaacacagtg
cccccagaagtgcctgccaacccagcatctgccagcacagtgacctccaagttgccacct
agctcaaagccccctggtgccgtgccttctaatgtgctcaccaatccagcaccatccaaa
ttgcccatcagttcaacccgtgctgtcatggtgccatccaaagtgcccagtagcatggtg
ctcaccacagggaatgccagcacagtccccaccagcaggagcagcagagctgaggagacc
ccagcagctccaacacctgcaggtgccactggaggcagctcagcctggctagacaatagc
tctgagaatgggggccttgggtcggagttgagcaagcctggcatgctggtatcccaggta
gacagcctattctcgggctgctctgaggatcttgccatcagtgccagcagctccttgggc
gtggggccctgccatggcccagaggagaatgaatacaagtccgagggcacctttgggatc
cacgtggctgagaaccccagcatccagctcctggagggcaaccctgggccacctgcggac
ctggagggtggccccaggccacacaccgaccagaagttccaggacgaggaggtgccatgc
cactggtcctcgcttgggtctccgtggctccaggcagctgtggcaggggtgctggcagcc
atactcctggcagtgctgtaccagcggcgccagctctag

DBGET integrated database retrieval system