KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410637
Entry
100410637         CDS       T03264                                 

Gene name
FFAR1
Definition
(RefSeq) free fatty acid receptor 1
  KO
K04325  free fatty acid receptor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100410637 (FFAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100410637 (FFAR1)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    100410637 (FFAR1)
SSDB
Motif
Pfam: 7tm_1 Cytochrome_B
Other DBs
NCBI-GeneID: 100410637
NCBI-ProteinID: XP_008978265
LinkDB
Position
1
AA seq 239 aa
LEAVEALAFRAWPLPXAMCPVFAVAHFAHSTPAGLPGCLSAGRYLGAAFPLGNQAFRKPC
YSWGVCTAIWALVLCHLGLVLALEAPGGWLDNSNTSLGINTPVNGSPVCLEAWDPASAAP
ARLSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGVLLTLLLCVGPYN
ASNVASFLNPDMGGPWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTGCAPRTQGGTSQK
NT seq 720 nt   +upstreamnt  +downstreamnt
cttgaagcagtggaggcgctggccttcagggcctggcctctgccangtgcaatgtgcccc
gtcttcgcggtggcccacttcgctcactctacgccagcgggacttcctggctgcctgagc
gccggccgctacctgggagctgctttccccctgggcaaccaagctttccggaagccatgc
tactcctggggggtgtgcacggccatctgggcccttgtcctgtgccacctgggcctggtc
cttgcattggaggctccgggaggctggctggacaacagcaacacctcgctgggcatcaac
accccggtcaacggctctcccgtgtgcctggaggcctgggacccggcctccgccgccccg
gcccgcctcagcctctctctcctgctctttttcctgcccttggccatcacagccttctgc
tacgtgggctgcctccgggcactggcccgctcaggcctgacacacaggcggaagctgagg
gccgcatgggtggccggaggggtgctgctcacgctgctgctctgcgtgggaccctacaac
gcctccaacgtggccagcttcctgaaccccgacatgggaggcccctggaggaagctgggg
ctcatcacgggtgcctggagtgtggtgctcaacccgctggtgaccggttacttgggaagg
ggtcctggcctgaagacagggtgtgcgccaagaacgcaagggggcacgtcccagaagtag

DBGET integrated database retrieval system