KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411002
Entry
100411002         CDS       T03264                                 

Gene name
CISH
Definition
(RefSeq) cytokine inducible SH2 containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04630  JAK-STAT signaling pathway
cjc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100411002 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100411002 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100411002 (CISH)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cjc04990]
    100411002 (CISH)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100411002 (CISH)
Domain-containing proteins not elsewhere classified [BR:cjc04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100411002 (CISH)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100411002
NCBI-ProteinID: XP_002758438
Ensembl: ENSCJAG00000005345
UniProt: F7GWT1
LinkDB
Position
15
AA seq 258 aa
MVLCVQGPHPLLAVEQTGQRPLWAQSLELPEPVMQPLPAGAFPEEVAEETRAQTESEPKA
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYANSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAP
TPALPMPKEDAPSNPALPTPPAATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQYPFQL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtcctctgcgttcagggacctcatcctttgctggctgtggagcagactgggcagcgg
cccctgtgggcccagtccctggaactgcccgagccagtcatgcagcccttgcctgctggg
gccttcccagaggaggtggcagaggagacccgagcccagacagagagtgagcccaaagcg
ctggaccccgaggaggatctgctgtgcatagccaagaccttctcctaccttcgggaatct
ggttggtattggggttctattacagccagcgaggcccggcaacacctgcagaagatgcca
gagggcacgttcctggtacgtgatagcacccaccccagctacctgttcacgctgtccgtg
aaaaccactcgtggccccaccaatgtgcgcattgagtatgccaactccagcttccgtctg
gattccaactgcttgtccaggccacgcatcctggccttcccagatgtggtcagccttgtg
cagcactatgtggcctcctgcgctgctgacacccgaagcgacagccccgatcctgctccc
actccggccctgcctatgcctaaagaagatgcgcctagtaacccagcgctgcctactcct
ccagcagccactgctgtacacctaaaactggtgcagccctttgtgcgaagaagcagtgcc
cgcagcctacagcacctgtgccgccttgtcatcaaccgtctggtggctgacgtggactgc
ctgccactgccccggcgcatggctgactacctccgacagtaccccttccagctctga

DBGET integrated database retrieval system