KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411953Help
Entry
100411953         CDS       T03264                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100411953 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100411953 (SETD2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100411953 (SETD2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100411953 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 100411953
NCBI-ProteinID: XP_017820358
Ensembl: ENSCJAG00000002303
LinkDB All DBs
Position
15
AA seq 2546 aa AA seqDB search
MFSWLNGNREEENEAKIENVQKTGFIKGPIFKGVASSRFLPKGTKTKVNLEEQGRQKVSF
SFSLTKKTLPNRFLTALGNEKQSDTPNPPAVPLQVDSTPKMKMEIGDTLSTAEESSPPKS
RVELGKIHFKKHLLHVTSRPLLATTTAVASPPTHAVPLPAVIAESTTVDSPPSSPPPPPP
PPQATTSSSPAPVTEPVALPHTPVTVLMAAPVPLPVDVAVRALKEPPIIIVPESLEADTK
QDTVSNSSEEHITHNLNEQADISSKKEDSHIGKDEEIPDSSKISLCCKKTGSKKKYSQSE
GTFLGSESDEDSVRTSSSQRSHDLKFSANIEKERDFKKSSAPLKSEDLGKSSRSKTERDD
KYFSYSKLERDTRYVSSRCRSERERRRSRSRSRSDRGSRTNLSYSRSERSHYYDSDRRYH
RSSPYRERTRYSRPYTDNRARESSDSEEDYKKTYSRRTSSHSSSYRDLRTSSYSKSDRDC
KTETSYLEMERRGKYSSKLERESKRTSENEAMKRCCSSPNELGFRRGLSYSKHDSSASRY
KSTLSKPISKSDKFKNSFCCTELNEEIKQSHSFSLQTPCSKGNELRMINKNPEREKPGTP
SPSNQLNDSPAFKKLDELPIFKSEFIAHDSHDSIKELDSLSKVKNDQLRSFCPIELNING
SPGTESDLATFCTSKADAVLMTSDDSVTGSEVSPLVKACVLSSNGFQNISRCKENDLDDT
CMLHNKSESPFRETEPLVSPHQNKLMSLPVMTIDYSKTVVKEPVDMRVSCCKTKDSDIYC
TSNDSNPSLCNSEAENIEPSVMKISSNSFMNVHLESKTVISDHRNLTDHSKFACEEYKQS
IGSTSSASVNHFDDLYQPIGSSGIASSFHSLPPGIKVDSLTLLKCGENISPGLDVVLKSK
KSSEFLKRAGKETIVEVGSDLPDSGKGFASREKRHNNGLSGKCLQEAQEEGNSILPVRRG
RPEISLDEGGERGRMHTSDDSEVVFSCDLNLTMEDSDGVTYALKCDSSGHAPEIVSTVHE
DYSGSSESSSDESDSEDTDSDDSSIPRNRLQSVVVVPRNSTLPMEETSPCSSRSSHSYRH
YSDHWEDERLESRRHSYEEKFESIASKACLQTDKFFLHKGTEKNSEISFTQSSRRQVDNH
LPELSHPQSDGVDSTSHTDVKSDHLGHPNSEETVKAKIPCRQQELPIYSSDFEDVPSKSW
QQTAFPNRPDSRLGKTELSFSSSCEIPHVDSLHSSEELRNLGWDFSQEKPTTTYQQPDSS
YGACGGHKYQQSAEQYGGTRDYWQGNGYWDPRSGRPGTGVVYDRTQGQVPDSLTDDREEE
ENWDQQDGSHFSDQSNKFLVSLQKDKGSVQAPEISSNSIKDIVAVNEKKDFSKNLEKNDI
KDRGPLKKRRQEIESDSESDGELQDRKKVRVEVEQEETSLPPGSALVGPSCVMDDFRDPQ
RWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGEIACGE
DCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLE
YCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQ
KWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIR
AAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLELI
QNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLPIPTKNMLEES
KVLPIIQRWSQTKTAVPPLSEGDGYSSENTSRAHTPLNTPDPSTKLSTEADTDTPKKLMF
RRLKIISENSMDSAISDATSELEGKDGKEDLDPLENVPVEEEEELQSQQLLPQQLPECKV
DSETSVEASKLPTSEPEADAEIEPKESNSTKLEEPINEETPSQDEEEGVSDVESERSQEQ
PDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENTITERGRDAVAFRDQTPAPKTPN
RSRERDPDKQTQNKEKRKRRGSLSPPASAYERGTKRPDDRYDTPTSKKKVRIKDRNKLST
EERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVD
PSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSS
QYVTQSDGVVHQDSSVAVLPVPAPGPVQGQNYSVWDSNQQPVSVQQQYSPAQSQATIYYQ
GQTCPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVVVQPAAAVTTIVAP
GQPQPLQPSEMIVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWD
PPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKEVFRKEM
SQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKH
KTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7641 nt NT seq  +upstreamnt  +downstreamnt
atgttttcttggctgaatggaaatagagaagaagaaaacgaggcaaagattgaaaatgtg
cagaaaacaggtttcatcaagggaccaatctttaaaggtgttgcttcgagtcgatttttg
cccaaaggcaccaagacaaaagttaatttggaagaacaaggtcgacagaaggtgtcattc
agcttcagccttacaaagaaaactttgccgaataggtttctcaccgcacttggcaatgaa
aagcaaagtgatactccaaaccctccagctgtacctcttcaggtagactcaacccctaaa
atgaaaatggaaatcggtgataccttatctactgcagaagaatcttctccaccaaagtca
agggtggaattgggcaaaattcattttaagaaacacctgcttcatgtaacatccaggcca
ctgctggctactaccacagcagtagcatctccacctactcatgcagtgccattaccagca
gtgatagcagaatcaacaactgtagactcaccgccctcatccccacctccaccgcctcca
cccccgcaagccacaacatcctcatcaccagcaccagtaacagagccagtggccttgcca
catacaccagtaacagttctgatggcagcaccagtacccttaccagtagatgtagcagtt
agagctctgaaagaaccaccaattataattgtaccagaatctttagaagcagatactaag
caggacactgtatctaatagttcagaagaacacataacacacaatttgaatgagcaagca
gatatttcctcaaaaaaagaagattcccatattgggaaggatgaagaaattcctgatagt
tctaagattagtctgtgctgtaaaaaaacaggttctaagaagaaatactcacaatctgaa
ggcacctttcttggttcagaatctgatgaagattctgtacggacttcttcaagtcaaaga
tcacatgatttaaaattttcagcaaacattgaaaaggaaagagattttaaaaagagctca
gcacctttaaaaagtgaggatctagggaagtcttcacgatctaaaacagagagagatgat
aaatattttagctattcaaaacttgaaagagatactcggtatgtatcttcccgatgtagg
tcagaaagagagcgacggcggagcagatctcgttctaggtctgacagaggctctagaact
aatttatcctattcccggtcagaacgatctcattattatgactctgatcgtcgctaccat
aggagctccccttatcgagagaggacacgttattctcgaccttacacagataacagagca
cgagagagttctgactcagaagaagactataagaagacatactcaaggcgtacctcatct
cattcctcttcttacagagacctaaggacatcatcttattctaaatctgatcgggactgt
aaaactgagacttcttacttagagatggaaagaagaggcaagtattcttcaaaactagaa
agagaatctaaaaggacttcagaaaatgaagcaatgaaaagatgttgttcttcccctaat
gaactgggattccgacgagggttatcgtattctaagcacgacagtagtgcttcccgttat
aaatctaccctttcaaaaccaatatccaagtctgataaatttaaaaattctttctgttgt
acagaattaaatgaagaaatcaaacagtctcattcttttagtttacaaacaccttgttca
aaaggtaatgaattaagaatgattaataaaaatcctgaaagagaaaagcctgggactcca
tctccatcaaatcaattaaatgattcacctgcttttaaaaagctagatgaattgcctatt
tttaagtctgaatttatagcacatgatagccatgatagtattaaggaattagactcttta
tctaaagtgaagaatgatcaattaagaagtttttgtcccatagaattaaatataaatgga
tctcctgggacagaatctgatttggcaacattttgcacttctaaagctgatgctgtttta
atgacttctgatgatagtgtgactggatcagaggtatcacctttggtcaaagcatgtgtg
ctttcatcaaatggatttcagaatattagtagatgcaaagagaatgacttggatgataca
tgcatgctacataataagtcagaaagcccatttagagaaacagaacctctggtgtcacca
caccaaaataaactcatgtctttgccagttatgactatagattattccaaaacagtagtt
aaagaaccagttgatatgagggtttcttgctgcaaaaccaaagattcagacatatactgt
acttcaaacgacagcaacccttctttgtgtaactccgaagctgaaaatattgagccttca
gttatgaagatttcttcaaatagctttatgaatgtgcatttggaatcaaaaacggttata
agtgatcatagaaatttgacagatcactcaaaatttgcatgtgaagaatataagcagagc
attggtagcactagttcagcttctgttaatcattttgatgatttatatcagcctattggg
agttcaggtattgcttcatcttttcatagtcttccaccaggaataaaggtggacagtcta
actctcttgaaatgtggagagaacatatctccaggtctggatgtagtactaaagagtaaa
aaaagttcggagtttttaaagcgtgcagggaaagaaacaatagtagaagtaggtagtgac
cttcctgattcaggaaagggatttgcctccagggagaaaaggcataataatgggctatct
gggaaatgtttgcaagaggctcaagaagaagggaattccatattgcctgttagaagagga
agaccagaaatctctttagatgaaggaggagaaagaggacgtatgcatacttctgatgat
tcagaagttgtattttcttgtgatttgaatttaaccatggaagacagtgatggtgtaact
tatgcattaaaatgtgacagtagtggtcatgccccagaaattgtgtctactgtccatgaa
gattattctggctcttctgaaagttcaagtgatgaaagtgattcagaagatacagattct
gatgacagcagtattccaagaaaccgtctccagtctgttgtggttgtgccaaggaattct
actttgcccatggaagaaacaagtccttgttcttctcggagcagtcacagttatagacac
tattctgaccattgggaagatgagagattggagtcaaggagacattcctatgaggaaaag
tttgaaagtatagcaagtaaagcttgtcttcaaactgataagtttttccttcataaagga
acagagaagaattctgaaatttcttttacacagtccagtagaagacaagtagataaccac
ctgcctgaactttctcatcctcagagtgatggggttgatagtacaagtcatacagatgtg
aaatctgaccatctgggtcacccaaattcagaggaaaccgtgaaagccaaaataccttgt
aggcagcaagaactgccaatttattcttctgattttgaagatgtcccaagtaagtcttgg
cagcagaccgctttcccaaacaggccagatagtagactgggaaaaacagaattgagtttt
tcttcctcttgtgagataccgcatgtggacagcttgcactcatcagaagagctcagaaac
ttagggtgggacttctctcaagaaaagcctactaccacgtatcagcaacctgacagtagc
tatggagcttgtggtggacacaagtatcagcaaagcgcagaacagtatggtggaacacgt
gattactggcaaggcaatggttactgggatccaagatcaggtagacctggaactggggtt
gtgtatgatcgaactcaaggacaagtaccagattccctaacagatgatcgggaagaagag
gagaattgggatcaacaggatggatcccacttttcagaccagtccaacaaatttcttgta
tcccttcagaaagacaaggggtcagtgcaagcacctgaaataagcagcaattccattaag
gacattgtagctgtgaatgaaaagaaagatttttcaaaaaacttggaaaaaaatgatatc
aaagatagagggcctcttaagaaaaggaggcaggaaatagagagtgattctgaaagtgat
ggtgaacttcaggacagaaagaaagttagagtggaggtagagcaggaagagacatcattg
cccccaggctcagcactggttgggccctcctgtgtcatggatgacttcagggacccacag
cgatggaaggaatgtgccaagcaggggaaaatgccttgttactttgatcttattgaagaa
aatgtttatttaacagaaagaaagaagaataaatctcatcgagatattaagcgaatgcag
tgtgagtgtacacctctttctaaagatgaaagagctcaaggtgaaatagcctgtggggaa
gattgtcttaatcgtctcctcatgattgaatgttcttctcggtgtccaaatggggattat
tgttctaatagacggtttcagagaaaacagcatgcagatgtggaagtcattctcacagaa
aagaaaggctggggcttgagagctgccaaagaccttccttcgaacacatttgtcctagaa
tattgtggagaggtacttgatcataaagagtttaaagcacgagtgaaggagtatgcacga
aacaaaaacatccattactatttcatggccctgaagaatgatgagataatagatgccact
caaaaaggaaattgctctcgtttcatgaatcacagctgtgaaccaaactgtgaaacccaa
aaatggactgtgaatggacaactgagggttgggttttttaccaccaaactggttccttca
ggctcagagttaacatttgactatcagttccagagatatggaaaagaagcccagaaatgt
ttctgtggatcagccaattgccggggttacctgggaggagaaaacagagtcagcatcaga
gcagcaggagggaaaatgaagaaggaacgatctcggaagaaggattcagtggatggagag
ctagaagctctgatggaaaatggtgagggtctctctgataaaaaccaagtgctcagctta
tcccggctaatggttcgaattgaaactttggagcagaaacttacctgtctggagctcata
cagaacacacactcacagtcctgcctgaagtcctttctggaacgtcatgggctgtctttg
ttgtggatctggatggcagagctaggtgacggccgggaaagtaaccagaagcttcaggaa
gagattataaagactttggaacacttgcccattcctactaaaaatatgttggaggaaagc
aaagtacttccaattattcaacgctggtctcagactaagactgctgtccctccattgagt
gaaggagatgggtattctagtgagaatacatcacgtgctcatacaccactcaacacacct
gatccttctacgaagctgagcacagaagctgacacagacactcccaagaaactcatgttt
cgcagacttaaaattataagtgaaaatagcatggacagtgcaatctctgatgcaaccagt
gagctagaaggcaaggatggcaaagaggatcttgatccattagaaaatgtccctgtagag
gaagaggaagagttgcagtcacaacagctactcccacaacagctgcctgaatgcaaagtt
gatagtgaaaccagcgtagaggccagtaagttacctacatctgaaccagaagctgatgct
gaaatagagcccaaagagagcaatagcacaaaactagaagaacctattaatgaagaaaca
ccatcccaagatgaggaggagggtgtgtctgatgtggagagtgaaaggagccaagaacag
ccagataaaacagtggatataagtgatttggccaccaaactcctggacagttggaaagac
ctaaaggaagtatatcgaattccaaagaaaagtcaaactgaaaaggagaacacaataact
gaacgaggaagggatgctgttgccttcagagatcaaacacctgccccaaagactcctaat
aggtcaagagagagagacccagacaagcaaactcaaaataaagagaaaaggaaacgaaga
ggctctctttcaccacctgcttctgcctatgagcggggaacaaaaaggccagatgacaga
tatgatacaccaacttctaaaaagaaagtgcgaattaaagaccgcaataaactttctaca
gaggaacgccggaagttgtttgagcaagaggtggctcagcgggaagctcagaaacaacag
caacagatgcagaacctgggaatgacatcaccactgccctatgactctcttggttataat
gcccctcatcatccctttgctggttatccaccaggttatcccatgcaggcctatgtggat
cccagcaaccctaatgctggaaaggtgctcctgcccacacccagcatggacccagtgtgt
tctcctgctccttatgatcatgctcagcccttggtgggacattctacagaacccctttct
gcccctccaccagtaccagtggtgccacatgtggcagctcctgtggaagtttccagttcc
cagtatgtgacccagagtgatggtgtagtacaccaagactccagcgttgctgtcttgcca
gtgccggcccccggcccagttcagggacagaattatagtgtttgggattcaaaccaacag
cctgtcagtgtacagcagcagtattctcctgcacagtctcaagcaaccatatattatcaa
ggacagacatgtccaacagtctatggtgtgacatcaccttattcacagacaactccacca
attgtacagagttatgcccagccaagtcttcagtatatccaggggcaacagattttcaca
gctcacccacaaggagtggtggtacagccagctgcagcagtgactacaatagttgcacca
gggcagcctcagcccttgcagccatctgaaatgattgtgacaaataatctcttggatctg
ccgcccccctctcctcccaaaccaaaaactattgtcttacctcccaactggaagacagcc
cgagatccagaagggaagatttattactaccatgtgatcacaaggcagactcagtgggat
cctcctacttgggaaagcccaggagatgatgccagccttgagcatgaagctgagatggac
cttggaactccaacatatgatgaaaaccccatgaagacctcgaaaaagcccaagacagca
gaagcagacacctccagcgaactagcaaagaaaagcaaagaagtattcagaaaagagatg
tcccagttcatcgtccagtgcctgaacccttaccggaaacctgactgcaaagtgggaaga
attaccacaactgaagactttaaacatctggctcgcaagctgactcacggtgttatgaat
aaggagctgaagtactgtaagaatcctgaggacctggaatgcaatgagaatgtgaaacac
aaaaccaaggagtacattaagaagtacatgcagaagtttggggctgtttacaaacccaaa
gaggacactgaattagagtga

DBGET integrated database retrieval system