KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412403Help
Entry
100412403         CDS       T03264                                 

Gene name
SRCAP
Definition
(RefSeq) Snf2 related CREBBP activator protein
  KO
K11661  helicase SRCAP [EC:3.6.4.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100412403 (SRCAP)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     100412403 (SRCAP)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Chromatin remodeling factors
   SRCAP complex
    100412403 (SRCAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Helicase_C HSA DEAD ERCC3_RAD25_C
Motif
Other DBs
NCBI-GeneID: 100412403
NCBI-ProteinID: XP_017834355
Ensembl: ENSCJAG00000002760
LinkDB All DBs
Position
12
AA seq 3220 aa AA seqDB search
MQSSPTPARPQFPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGP
PGPPDGATVPLEGFNLPQAADLANKGPKWEKSHAEIAEQAKHEAEIETRIAELRKEGFWS
LKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKE
ERARREEQAKLRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQT
EKYSDLLSQSLNQPLSSSKAGSSPCLGSSSAASSPPPPASRLDDEDGDFQPQEEEEEDDE
ETIEVEEQQEGNDAEAQRREIELLRREGELPLEELLRSLPPQLLGGASSPSRTPSSHDSD
TRDGPEEGAEEDPSQVLEVKAPPSALTQCNKRPWHPDEDDEEFTANEDEAEDEEDTIAAE
EQLEGEVDHAMELSELAREGELSMEELLQQYAGAYAPGSGSSDDEDEDEVDANISDCEPE
GTVDAEEVPQEDSSSQSDSAEDQSEDEEDEHSEEEEESGSSASEESESEESEDAQSQSQA
DEEEEDDDFGVEYLLARDEEQSEADAGSGPPTPGPTTTLGPKKEITDIAAAAESLQPKGY
TLATTQVKTPIPLLLRGQLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAH
LACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSFKILTYYGAQKERKLKRQGWTKPNAFH
VCITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQ
NSLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRLHKVLRPFLLR
RVKVDVEKQMPKKYEHVIRCRLSKRQRCLYDDFMAQTTSKETLATGHFMSVINILMQLRK
VCNHPNLFDPRPVTSPFITPGICFSTASLVLRATDVHPLQRIDMGRFDLIGLEGRVSRYE
ADTFLPRHRLSRRVLLEVATAPDPPPRPKPVKMKVNRMLQPVPKQEGRTVVVVNNPRTPL
GPVPVRPPPGPELSAQPTPGPTPPVLPAPLMVSASPTGPPLIPASRPPGPVLLPPLQPNS
GSLPQVLPSPLGVLSGTSRPPTPTLSLKPTPPAPVRLSPAPPPGSSSLLKPLTVPPGYTF
PPAAATTTSTTTATATTTAVPTPTPAPQRLILSPDMQARLPSGEVVSIGQLASLAQRPVA
NAGGSKPLTFQIQGNKLTLTGAQVRQLAVGQPRPLQRNVVHLVSAGGQHHLISQPAHVAL
IQAVAPTPGPTPVSVLPSSTPSTTPAPTGLSLPLAANQVPPTMVNNTGVVKIVVRQAPRD
GLTPVPPLAPAPRPPSSGLPAVLTPRPTLTPGRLPTPSLGTARTPMPTPTLVRPLLKLVH
SPSPEISASTPGAAPLTISSPLHVPSSLPVPASSPMPVPNSSPLASPVSSTVSVPVSSSL
PISVPTTHPAPASAPLTIPMSTPLPVSASGPALLTNVTPPLAPVVPAAPGPPSLAPAGAS
PSASALTLGLATAPSLSSFQTPGHSLLLAPTSSHVPGLNSAVPPACSPVLVPASALANPF
PAAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPPAPPLAPLPVLAPSPGPAP
VLASSQTSVPVMAPSSTPGNPLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQT
LALPPALAPTLGGSSLSQTLSVGTGNSQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPPL
GPTQTLSLAPASPMGPTPAHTLTLAPASSTASLLAPASVQTLTLSPAPIPTLGPAAAQTL
ALAPASTQSPASQASSLVVSASGATPLPVTMVSRLPVSKDEPDTLTLRSGPPSPPSTATS
FGGPRPRRQLPPPPRSPFYLDSLEEKRKRQRSERLERIFQLSEAHGALAPVYGAEVLDFC
TLPQPVASPIGPRSPGPSHPTFWTYTEAAHRAVLFPQQRLDQLSEIIERFIFVMPPVEAP
PPSLHACHPPPWLAPRQAAFHEQLASELWPRARPLHRIVCNMRTQFPDLRLIQYDCGKLQ
TLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMERFN
ADKRIFCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRL
ISERTVEENILKKANQKRMLGDMAIEGGNFTTAYFKQQTIRELFDMPLEEPSSSSVPSVP
EEEEETVASKQTHILEQALCRAEDEEDIRAATQAKAEQVAELAEFNENDGFPAGEGEEAS
RPGAEDEEMSRAEQEIAALVEQLTPIERYAMKFLEASLEEVSREELKQAEEQVEAARKDL
DQAKEEVFRLPQEEEEGLGAGDESSCGTGGGSHRRSKKAKAPERPGTRVSERLRGARAET
QGANYTPIISAHQTRSTTTLPRCSPARERVPRPAPRPRPTPASAPAAIPAPVPVPVSVPL
PISAPNPITILPVHILPSPPPPPQIPPCSPACTPPPACTPPPAHTPPPAQTSLLTPFPLL
VGPPSVPISPPVTSLPLGLRPEAELCAQALASPESLELATVASSETSSLTLVPPKDLLPV
AVEILPVSEKNLSLAPSASSPTLEAGNVPNGQEQEAPDSAEGTTVTVHPEGEELPVCVSE
SNGLELLPSAASHEPLQEPLEADRNSEELAEAQTPTFSPEKPQELVTAEVTAPSTSSSAT
SSPEGSSPARPPRRRTSADVEIRGQGTGRPGQPPGPKVLRKLPGRLVTVVEEKELVRRRR
QQRGAASTLVSGVSETSASPGSPSVRSMSGPESSPPTSGPCEAAPSSSLPTPPQQPFIAR
RHIELGVTGGGTPENGDGALLAITPPAVKRRRGRPPKNRSPADAGRGVDEAPSFTLKGKT
NGADPVPGAGTLIIGEPVLEPQLIPGPQPLGSQSVHRPNPILSPVEKRRRGRPPKARDLP
IPGIISSPGDGNSESRTQPPPLPPPLTPLPPLLACPSATVANTVTTVNISASPPKRKRGR
PPKNPPSPRPSQLPVLDRDSTSVLESCGLGRRRQPQGQGESEGSSSDEDGSRPLTRLARL
RLEAEGIRGRKSGGSMVVAVIQDDLDLVDSGPGGLELTPPVVSAPKLRSTRLRPGSLVTP
LETEKVPRKRAGAPVGGGPGPAKRGRLQPPSPLGPEGSVEESEPEPSGEEEEGDGTPHRR
PGPRRLVGTTNQGDQRILRISAPPSLAGPAVSHRGRKAKT
NT seq 9663 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcagccccacccctgctcgccctcagttcccagtcctacagacacagatggtg
tcggacggcatgacaggcagcaatcctgtgtcccctgcctcatccagttccccagcctct
agtggggcaggtggcatctccccccagcacatagctcaagattcttctctggatggacct
ccaggccccccagatggtgcaacagtgcccctggaggggttcaacttaccccaggctgct
gacctggctaacaagggcccaaagtgggagaaaagccatgccgaaatcgcagaacaggcc
aagcatgaggccgagattgagactcggattgctgagctgcggaaggagggtttctggtca
ctgaagaggctgcctaaggtgccagagccccctcgccccaaaggtcactgggactatctg
tgtgaagagatgcagtggctctctgctgactttgctcaggagcgccgttggaaacggggt
gtagcacgtaaggtggtacgcatggtgatccggcaccacgaagagcagcggcagaaagag
gaacgggcccggagggaggagcaggccaagctgcgtcgaatcgcttccactatggccaag
gatgtcaggcagttctggagcaatgtggagaaggtggtgcaattcaaacaacagtctcgg
cttgaggaaaagcgcaaaaaagccctggacctgcatttggacttcattgtggggcaaact
gaaaagtactcggaccttctgtctcagagcctcaaccagccattatcctccagcaaagca
ggctcttccccttgccttggctcttcctcagctgcctccagtcctccaccccctgcttcc
cgcctggatgatgaagatggggactttcaaccccaagaggaggaggaagaggatgatgag
gaaacgattgaggttgaagaacaacaggaaggcaatgatgcagaggcccagaggcgtgag
attgagctgcttcgccgtgagggagaactgccactggaagagctgctccgttcccttccc
cctcagctgctgggaggggcttccagcccctctcgaaccccctcatctcatgatagtgac
acccgagatgggcccgaagaaggtgctgaagaagatccctctcaggtgttggaggtaaag
gctccaccctctgctctcacacagtgcaacaaacgtccttggcatccagatgaagatgat
gaagagtttactgccaatgaggatgaagcggaggatgaagaggacacaatagcagctgag
gaacagttggaaggggaagtggatcatgccatggaactgagtgaattggctcgagaaggt
gagctttccatggaggaactattacagcagtatgcaggagcctatgccccaggctctggg
agcagtgatgatgaggatgaagatgaagttgatgctaatatctctgactgtgaaccagag
gggaccgtggacgcggaagaggttcctcaagaggatagtagcagtcagtcagactccgca
gaggaccagagtgaggatgaggaagatgagcattcagaggaggaagaagaaagtggaagt
tcagcatcagaggaatctgaatctgaagagtctgaggatgcccagtcacagagccaagca
gatgaagaggaggaagatgatgattttggggtagagtacttgcttgccagggatgaagag
cagagtgaggcagatgcaggcagtgggcctcccactccagggcccaccactactctaggt
ccaaagaaagaaattactgacattgctgcagcagcggaaagtctccagcccaagggttac
accctggccactacccaggtaaagacacccatccccctgcttttgcggggccaactccgg
gagtaccagcacattggactagactggctggttaccatgtatgagaagaagcttaatggc
attcttgctgatgagatggggcttgggaagaccatccagactatctccctgcttgcccac
ttggcttgtgagaaaggtaactggggtccccatttaatcattgttcccaccagcgtgatg
ttgaactgggagatggagttgaaacgttggtgccccagctttaaaatcctcacttactat
ggagcccagaaagagaggaagctcaagcggcagggctggaccaagcccaatgccttccat
gtgtgtatcacgtcttacaagctggtgctgcaggaccaccaggccttccgccgtaagaac
tggcgctatcttattctggatgaggcgcagaacatcaagaacttcaagtcacagcgctgg
cagtcactcctcaacttcaacagccagaggcgcctgctcttgacgggaactcccttgcag
aacagcctcatggagctgtggtccttgatgcactttttgatgccccatgtcttccagtct
catcgagagttcaaggagtggttctctaatcccctaactggcatgattgagggcagccaa
gaatataatgaaggtctagtcaagcgcctccacaaggttttgaggccttttttactgcgc
cgagttaaggtggatgttgagaagcagatgcccaaaaagtatgagcatgttatccgctgc
aggctctccaagcgtcaacgctgtctctatgatgacttcatggcacagaccacatctaag
gagacactagccacaggccatttcatgagtgtcatcaacattttgatgcagctgagaaaa
gtttgcaatcatccaaatctgttcgaccctcgacctgttacctcccctttcatcacccca
ggcatctgcttcagcaccgcctctctggtgcttagggccactgatgtccatcccctccag
cggatagacatgggtcgatttgaccttattggcctggaaggtcgtgtctctcgatatgag
gcagacacatttctgccccggcaccgcctctctcgccgggtactgctagaggtggctact
gctcctgaccccccaccccggcccaagccagtcaagatgaaggtcaacaggatgctacag
ccagtacctaagcaagaaggccggacagtggtggtggtgaacaacccacggacgcccctg
ggccctgtcccagttcgaccccctccaggtcctgagctctcagcccagcctacccctggc
ccaacccccccagtgctgccagcaccactgatggtttcagcctcacctactgggcccccg
cttattcctgcgtctcggcctcctggccctgtcctcttgcctccactgcagcccaacagt
ggttctctccctcaggtgttgccatcccccctgggggtcctcagtgggacctcacggcct
cccacgccaaccttgtccctaaagccaacaccacctgccccagttcgcctgagcccagcc
ccacctccaggctcctctagcctgttgaagcccctgacagtgccaccaggctacaccttc
cctcctgctgctgccaccaccacctctaccactacagcaactgctaccactacagcagtg
ccaactccgactcctgcaccacagcgcctcattctatctcccgatatgcaggctcgcctg
ccctcaggtgaagtggtcagcatcgggcagttagcctcattggcacaacgtccagtggct
aatgcagggggaagcaaacctctcaccttccaaatccagggcaacaagctgactttgact
ggtgcccaggtgcgccagcttgctgtggggcagccccgcccgctgcaaaggaatgtggtg
catctcgtgtcagcaggggggcagcaccacctcatcagccagcctgcccatgtggccctc
atccaggccgtggccccgacccctggtcctacccctgtctctgtgctgccttcttcgacc
cccagcaccacccctgcccccactggcctcagccttccgcttgctgctaaccaggtgcca
ccaaccatggtgaataatacaggcgtggtgaagattgtagtgagacaagcccctcgggat
ggactgactcctgttcctccgttggccccagcaccccggcctccgagctctgggcttcca
gctgtgttgactccacgccccacgttaacccctggccggctacccacacctagtctgggt
actgcccgaacccccatgcccacacctactctggtgaggcctcttctcaagctggtccac
agtccttcacctgaaatcagtgcgtcaacccccggagctgcccctttgaccatctcttct
cctctccatgtgccatcctcactccctgtgccagcctcttctccaatgccagttcccaac
tcttctccccttgctagtcctgtgtcctctacggtctcagttccagtgtcatcttcactc
cccatctctgtccccaccacccatcctgccccggcctcagctccactcaccatccccatg
tcaacccccttgcctgtttcggcttcgggcccagctctgttgaccaatgtgactccacca
ctggcaccagttgtcccagcagctcctggacctccctccttggcaccagctggggcttcc
ccatcagcatcagccttgactctaggtttggccacagctccgtccctgtcttcatttcag
acacctggtcactctctattgttggctcccacctcttcacatgttccagggttgaactca
gctgtgcccccagcatgctcaccggtcctggtgccagcttcagctctggccaatcctttt
ccggcagcaccaaatccagctccagctcaggcttcccttctggctccagcatcttctgca
tctcaggctctagccacccctctggctcctatggcggctccacagacagcaattctggct
cctccggctcctcctctggctcctcttccagtcctggcaccatcgccaggtcctgctcct
gtcctggcttcgtcgcagacttcagttccagttatggctccatcatctactccaggaaac
cctttagcctcagcttcaccggtaccagctccaacccctgtgttggctccatcatcaact
caaactatgctaccagccccagttccatcacctctcccgagcccagcttctacgcagaca
ctggccctacccccagctttagcacccactcttggaggctcatctctgtctcagacactc
tctgtgggaacggggaactcccagggaccctttccaactcagacattgtcattgacccca
gcatcatccctggtaccaactccagcccagacactgtctttggcaccaggaccacctctg
ggtccaactcagacgctgtctctggctccagcttctccgatgggcccaaccccggctcac
acgctgactttggctccagcatcgtcaactgcttcactcctggccccagcttcagtgcag
acactgactttgagccctgcccccattcctaccctgggcccggctgcagctcagaccttg
gcgctggccccagcctctacacagtccccagcttcccaggcatcttcccttgtggtttcg
gcatctggtgccactcccttgcctgtcaccatggtatcccggctgcctgtttcaaaggat
gagcctgacacactgacattgcgctctggtccccccagccctccctccactgctacctcg
tttggtggcccccggcctcgacgccaactccccccaccacctcgttcccctttctatctg
gactccctggaggaaaagcggaagcggcagcggtctgaacgcctggaacggattttccaa
cttagtgaggctcatggggccctggcacccgtgtatggggctgaagtcctggatttctgt
accctgccccaacctgttgccagccccattggccctcgttctcctggccccagccacccc
accttttggacttatactgaggctgcccaccgggctgtactgtttccccagcagcgacta
gaccagctgtcagaaatcattgagaggttcatctttgtcatgcctcctgtggaggcacct
cccccttccctgcatgcctgccacccacctccttggctggccccacgtcaggcagccttc
cacgagcaattggcctctgagctctggccccgggctcgtcctctgcaccgtattgtctgt
aacatgcgcacccagttccccgacttgagactcatccagtatgattgcggaaagttgcag
acgttggcagtgctgttacggcagctcaaggcagagggtcaccgagtgctcatcttcacc
cagatgacccgaatgctggatgtattggagcagtttctcacctaccatggccatctctac
ctgcgtctggatgggtctactagagttgagcagagacaggccttgatggaacggttcaat
gcagacaaacgcatattctgcttcatcctttcaactcggagtgggggtgtgggcgtgaac
ctgacaggagcagacactgttgttttttatgacagcgactggaatcccaccatggatgct
caggcccaggaccgctgtcaccgaattggccagacccgggatgtccacatatataggctt
atcagtgaacggacagtggaggagaacattctaaaaaaggcaaatcagaagagaatgttg
ggagacatggccattgagggaggcaatttcaccacagcctattttaaacagcaaaccatc
cgagagctgtttgatatgcccttggaggaaccttctagctcatctgtgccctctgtccct
gaagaggaggaagagactgtggccagcaagcagactcatattctggagcaggcattgtgc
cgggcagaagatgaggaggatatccgtgcagccacccaggccaaggctgaacaggtggct
gagcttgcagaatttaatgagaatgatgggtttcctgctggtgaaggagaggaggccagc
cggcctggggctgaggatgaggagatgtcccgggctgagcaggaaattgctgcccttgta
gaacagctgacccccattgagcgctatgccatgaaattcttggaggcctcactcgaggag
gtgagccgagaggagctcaaacaggcagaagagcaagtggaagctgcccgaaaagacctg
gaccaagccaaggaggaagtgttccgcctaccccaagaggaagaggagggactgggggct
ggggatgagagttcctgtgggactggtggaggcagccaccggcgcagtaaaaaggccaaa
gcccctgagaggccagggactcgtgtcagtgagcgtcttcgtggagcccgggctgagact
caaggggcaaactacactcctatcatatctgcccatcaaactcgcagcaccaccacgctg
ccccgctgcagtcccgccagggagcgagttcccaggccagcacctaggcctcgacccact
ccagcttcagctccagctgcaattcctgcccctgtccctgtcccagtctctgtcccatta
cccatttcagccccaaatccaataaccattcttcctgtccatatcttgccttctcctccc
cctcctccacagattcctccttgttctcctgcctgtacccctcctcccgcctgtacccct
ccaccagctcatacacctcctccagcccaaacctctcttttaactccctttcctctcttg
gttggtccaccttctgtgcccatctctcccccagtcaccagcctccccttgggcttgagg
cctgaggcagaactgtgtgcccaggcattggcatctccagagtccctggaactggctact
gtggccagttcagagacctcctcacttactcttgtgcctcctaaagatctgttgccagtt
gctgtggagatcttgcctgtgtcagagaagaacctttctctcgccccttctgcatccagt
ccaaccttggaggctggcaacgtccccaacggtcaagagcaggaggcaccagattctgct
gaggggaccaccgttacagtgcatcctgaaggtgaagagttgcccgtgtgtgtgagtgaa
agcaatggcctggagctcctaccctcagcagcatctcatgagccacttcaggagcccttg
gaggctgacaggaactcagaagagctggcagaggcccagaccccaaccttcagcccagag
aagccacaggaactcgtaacagctgaggtcacagctccatccacctcatcttcagccact
tcttcgcctgagggttcttcacctgcccgacctcctcggcgtcgcaccagtgctgatgtg
gaaattaggggtcaagggactggtcggccagggcaaccaccaggccccaaagtacttcga
aagctgccaggacggctagtaactgtggtagaggaaaaggaactggtgcggcggcggcgg
cagcagcggggagctgccagcaccttagtgtctggggtctctgagactagtgccagccca
ggaagtccatctgttcgaagtatgtcagggccagaatcctcccctcccactagtgggccc
tgtgaagctgctccttcatcctcactgcccactccaccgcagcagcccttcatcgctcgc
cgtcacattgagctgggggtgactggtggtggcaccccagagaatggagacggagcactg
cttgccatcaccccacctgctgtgaaacgtcggagggggaggcctcccaagaacaggtct
ccagcagatgctgggagaggtgtggatgaggcaccctcattcaccttgaagggaaaaacc
aatggggctgacccagtccctggggctgggaccctaattattggagagcctgtcctggaa
ccacagcttattcccgggccccagcctcttggatcccagtcagttcacagacccaatccc
atcctgtcacctgtggagaaaagaaggcgaggacggccccctaaggcacgagatttgccc
atccctgggatcatttcctctccaggggatggcaactccgaaagtcggacacagccaccc
ccgctcccaccacccctaaccccactcccaccactgctagcttgtccctccgctactgtt
gccaacactgtcaccactgtcaacatttcagcgtctccacccaaacggaagagaggccga
cctcccaagaatcctccatcacctcggcccagccagctccctgtgttggaccgtgacagc
acttctgtccttgaaagctgtggattggggaggcgacggcaaccccagggccagggggag
agtgagggcagttcttctgatgaagatggaagccgcccccttacccgcctggcccgcctt
cggcttgaggcagagggaattcgaggacggaagagtggagggtccatggtggtggccgta
attcaggatgacctggacttagtagatagtgggccaggcgggttggaactgacacctcct
gtggtctcagccccaaaactgcgctcgacccggctgcgtccagggtctctagtcacccca
ctagagactgagaaggtgcctcgcaaacgagcaggggccccagttggtgggggtcctggg
ccggcgaagcggggccgcctacagcccccaagtcccctggggcctgagggttcagtagag
gagtctgaacctgaaccctcaggtgaggaggaggaaggggatgggaccccacacagacgg
cctggcccccgcaggcttgttgggaccaccaaccaaggggaccagcgcatcctgcgcatc
agtgcccctccctccctggctggccctgctgttagtcacagaggccgcaaggccaagacg
tga

DBGET integrated database retrieval system