KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412533
Entry
100412533         CDS       T03264                                 

Gene name
PTPN2
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 2
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100412533 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100412533 (PTPN2)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100412533 (PTPN2)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100412533 (PTPN2)
SSDB
Motif
Pfam: Y_phosphatase DSPc IKKbetaNEMObind
Other DBs
NCBI-GeneID: 100412533
NCBI-ProteinID: XP_002757082
Ensembl: ENSCJAG00000005102
UniProt: U3DFJ3
LinkDB
Position
13
AA seq 387 aa
MPTTIEQEFEELDAHRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLIDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRTVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKQWKELSKEDLSPA
FDYSPNKITTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRPRLTDT
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgcccacaactatcgagcaggagtttgaggagctggatgctcatcgtcgctggcagccg
ctgtacttggaaattcgaaatgagtcccatgactatcctcatagagtggccaagtttcca
gaaaacagaaatcgaaacagatacagagatgtaagcccatatgatcacagtcgtgttaaa
ctgcaaaatgccgagaatgattatattaatgccagcttaattgacatagaagaggcacaa
aggagttacatcttaacacagggtccacttcctaacacatgctgccatttctggcttatg
gtttggcagcagaagaccaaagcagttgtcatgctgaaccgcacagtggagaaagaatcg
gttaaatgtgcacagtactggccaacagatgaccaagagatgctgtttaaagaaacagga
ttcagtgtgaagctcttgtcagaagatgtgaagtcgtattatacagtacatctactacaa
ttagaaaatatcaatagtggtgaaaccagaacaatatctcactttcattatactacctgg
ccagattttggagtccctgaatcaccagcttcatttctcaatttcttgtttaaagtgaga
gaatctggctccttgaaccctgaccacgggcctgcggtgatccactgtagtgcaggcatt
gggcgctctggcaccttctctctggtagacacttgtcttgttttgatggaaaaaggagat
gatattaacattaaacaagtgttattgaacatgagaaaataccgaatgggtcttattcag
accccagatcaactgagattctcatacatggctataatagaaggagcaaaatgtataaag
ggagattctagtatacagaaacaatggaaagaactttctaaggaagacttatctcctgct
tttgattattcaccaaacaaaataacaactgaaaaatacaatggaaacagaataggtcta
gaagaagaaaaactgacaggtgaccgatgtacaggactttcctctaaaatgcaagataca
atggaggagaacagtgagagtgctctacggaagcgtattcgagaggacagaaaggccacc
acagctcagaaggtgcagcagatgaaacagaggctaaatgagaatgaacgaaaaagaaaa
aggccaagattgacagacacctaa

DBGET integrated database retrieval system