KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412560Help
Entry
100412560         CDS       T03264                                 

Gene name
PPEF2
Definition
(RefSeq) protein phosphatase with EF-hand domain 2
  KO
K13807  serine/threonine-protein phosphatase with EF-hands [EC:3.1.3.16]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100412560 (PPEF2)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100412560 (PPEF2)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   PPEF/PP7 protein phosphatases
    100412560 (PPEF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 PPP5 EF-hand_8 IQ SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 100412560
NCBI-ProteinID: XP_002745758
Ensembl: ENSCJAG00000014333
LinkDB All DBs
Position
3
AA seq 753 aa AA seqDB search
MGSGTSTQHHFAFQNAERAFKAAALIQRWYRRYMARLEMRRRCTWSIFQSIEYAGQQDQV
KLHGFFSYLMDHFTPSSHNERDFLTRIFTEERFAQDSKMEKCSDYESIEVPDSYRGPHLS
FPLLPDHATALVEAFRLKQQLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDL
HGQLDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGN
HEDHMVNLRYGFTKEVMNKYKIHGKEILRTLKDVFCWLPLATLIDEKVLILHGGVSDITD
LEILDKIERCKIVSIMRYKTRQKSEKQMEEQRKANQKSSAQGPIPWFLPQSRSLPSSPLR
LGPYKAHKSSRSSSIPCGGSLDGQELSQQVRSSVELELERCRQQAGLLVTEEKEEPSGSA
SETDSDTGELRKPTQEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTEQLLQKYN
LQFLIRSHECKPEGYEFCHNRKVVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQRQ
VTHTLTMRQRISRVEESALRALREKLFAHSSDLLIEFKKHDVDKVGLITLSDWAAVVESV
LHLGLPWRMLRPQLVNSSADNMLEYKSWLKNLAKEQLSHENIQSSLLETLYRNRSNLETI
FRIIDSDHSGFISLDEFRQTWKLFSSHMNIDVADDCICDLARSIDFNKDGHIDINEFLEA
FRLVEKSCPEGDASECPQATNAEDSGCSSPDAR
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcggcacctccacccaacatcattttgctttccagaatgcagagagagccttc
aaggcagcagccctgatccagagatggtaccggcgctatatggcccgcctggagatgagg
cggcgttgcacctggagcatcttccagtctatagaatacgctgggcagcaagaccaagtc
aagctccatggtttcttcagctatctcatggatcacttcacccccagcagccacaacgag
agggacttcctcacccgaatattcactgaggagagattcgcccaggactccaagatggag
aaatgcagtgactatgagtccatagaggtacccgacagttacaggggaccacacctctcc
ttcccgctcctgcctgaccatgctactgccctggtagaagcattcagactgaaacaacag
ctccacgctcgctacgtcttgaaccttttgtatgaaaccaagaaacatctggtacagctg
ccaaacatcaaccgggtttcaacctgttacagtgaggagatcacagtgtgtggagattta
catggccaattggatgacttaatatttatattttataagaacggcctcccatcgccagaa
cggtcatacgtgttcaacggtgactttgtggatcgaggcaaggattcagtagagatcctg
atgattctttttgccttcatgctggtttaccccaaagagttccatcttaacagaggaaac
catgaggaccatatggtgaacttacgatacggcttcaccaaggaagtgatgaataaatac
aagatacatggcaaggaaatactaagaaccctgaaagacgttttctgttggcttccgctg
gccactctgatagacgagaaagttctaattcttcatggtggggtgtcagacataactgat
ctggagattttggacaaaatagagaggtgcaagatagtttccatcatgaggtacaaaacg
agacagaagagtgagaagcagatggaggagcagagaaaagccaaccagaagagctccgca
cagggacccatcccatggtttctcccccaaagccgctctcttccctcttccccccttcgt
ctgggcccctacaaggctcacaaaagcagcaggtcctccagcatcccctgtggcggatcc
ctggatgggcaggagctctcccagcaggtgcggagctccgtggaactggagctggagcgg
tgccggcagcaagcaggcctcctggtgaccgaggagaaagaggagccctcgggctcggcc
tcagaaacagactctgacaccggagagctgcggaagcccactcaggaggagtggaggcag
gttgtagacatcctgtggagtgatcccatggctcaagagggctgcaaggccaacaccatt
cgaggaggaggctgttattttgggcctgatgtgacagaacagttgctacaaaaatacaat
ctgcaattcctgatccgttcacacgaatgcaaacccgaaggctatgaattctgtcacaac
cgcaaggtagtattaaccatcttttctgcctccaactactatgaagttggcagcaacaga
ggggcctatgtcaaactggggccagccctgaccccacatatcgtgcagtatcagcgacag
gtgacccacacactcaccatgaggcaaaggattagcagagtggaggagtcggctctgaga
gctctgcgggagaagctgtttgctcattcttcagatcttctcatcgaatttaagaagcat
gatgtagataaagtcggtttaatcaccctgagtgactgggctgcagtggtggagtctgtg
ttgcatctaggactgccatggcggatgctgaggccacagctggtgaacagctcagcagat
aacatgctggagtacaagtcttggctgaagaacttggccaaggaacaactgagccatgag
aacatacaatcaagtttgctggaaacactgtatcgaaaccgatccaacctggagaccatt
tttaggatcatagacagtgatcattcagggttcatctcactggacgagttcagacagacc
tggaagctgttcagctctcatatgaatatcgacgttgcagatgattgcatctgtgacctt
gcgcggagcattgatttcaacaaagacggccacatcgatatcaatgagttcctggaggcc
ttccgccttgtggagaaatcctgcccagagggtgatgcctcagaatgcccacaagctaca
aatgctgaagacagtggctgcagcagtccagatgcacgctaa

DBGET integrated database retrieval system