KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412806
Entry
100412806         CDS       T03264                                 

Gene name
SLC45A3
Definition
(RefSeq) solute carrier family 45 member 3
  KO
K15379  solute carrier family 45, member 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05202  Transcriptional misregulation in cancer
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100412806 (SLC45A3)
   05206 MicroRNAs in cancer
    100412806 (SLC45A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100412806 (SLC45A3)
Transporters [BR:cjc02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   100412806 (SLC45A3)
SSDB
Motif
Pfam: MFS_1 MFS_2
Other DBs
NCBI-GeneID: 100412806
NCBI-ProteinID: XP_002760769
Ensembl: ENSCJAG00000010943
UniProt: A0A2R8MSZ7
LinkDB
Position
19
AA seq 553 aa
MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG
PVLGLVSVPLLGSASDHWRGRYGRRRPFIWALSLGILLSLFLIPRAGWLAGLLCPDPRPL
ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPA
IDWDTSALAPYLGTQEECLFGLLTLIFLTCVAATLLVAEEAVLGPAEPAEALSAHSLPPR
CCPCQARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL
YQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRFGTRAVYLASVA
AFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDAGG
TSSEDSLITSFLPGPKPGAPFPNGHVGAGGSGLLPPSPSLCGASACDVSVRVVVGEPAEA
RVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQ
VVFDKSDLARYSV
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggtccagaggctgtgggtgagccgcctgctgcggcaccggaaagcccagctcctgctg
gtcaacctgctaacctttggcctggaggtgtgtttggccgcaggcatcacctatgtgccg
cctctgctgctggaagtgggcgtggaggaaaagttcatgaccatggtgctgggcatcggt
ccagtgctgggcctggtctctgtcccgctcctaggctcagccagtgaccactggcgcgga
cgctatggccggcggcggcccttcatctgggcgctgtccttaggcatcctgctgagcctc
tttctcatcccgagggctggctggctggcagggctgctgtgcccggatcccaggcccctg
gagttggcactgctcatcctgggtgtggggctgctggacttctgcggccaggtgtgcttc
accccactggaggccctgctctctgacctcttccgggacccggaccactgtcgccaggcc
tactccgtctatgccttcatgatcagtcttgggggctgcctgggttacctcctgcctgcc
attgactgggacaccagtgccctggccccctacctgggcacccaggaggagtgcctcttt
ggcctgctcaccctcatcttcctcacctgtgtagcagccacactgctggtagcagaggag
gcggtgctgggcccagccgagcccgcagaagcactgtcagcccactccctgccgccccgc
tgctgtccatgccaggcccgcctggctttccgaaacttgggcgcgctgcttccccgtcta
caccagctgtgctgccgcatgccccgtaccctgcgccggctcttcgtggctgagctgtgc
agctggatggcactcatgaccttcacgctgttttacacggatttcgttggtgaggggctg
taccagggcgtcccccgagctgagccgggcactgaggcccggagacactatgatgaaggt
gtgcggatgggcagtctggggctcttcctgcagtgcgccatctccctggtcttctctctg
gtcatggaccggctggtgcagcgatttggcacccgtgcagtctatctggccagtgtggca
gctttccctgtggctgccggtgccacatgcctgtcccacagtgtggccgtggtgacggct
tcagctgccctcaccgggttcaccttctcagccctgcagatcctgccctacacactggcc
tccctctaccaccgggagaagcaggtgttcctgcccaaataccgaggggacgctggaggc
accagcagtgaggacagtctgataaccagcttcctgccaggcccgaagcctggagctccc
ttccccaatggacacgtgggtgctggaggcagtggtctgctcccaccttcaccctcgctc
tgcggggcctctgcctgtgatgtctctgtgcgcgtggtggtgggtgagcccgccgaggcc
agggtggttccaggccggggcatctgcctggaccttgccattctggatagtgccttcctg
ctatcccaggtggccccgtccctgttcatgggctccattgtccagctcagccagtctgtc
actgcttatatggtgtctgccgcaggcctgggtctggttgccatttactttgctacacag
gtagtatttgacaagagcgacttggccagatactcagtatag

DBGET integrated database retrieval system