KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413078Help
Entry
100413078         CDS       T03264                                 

Gene name
FMNL2
Definition
(RefSeq) formin like 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: FH2 Drf_FH3 Drf_GBD DsrC
Motif
Other DBs
NCBI-GeneID: 100413078
NCBI-ProteinID: XP_017828968
Ensembl: ENSCJAG00000015629
LinkDB All DBs
Position
6
AA seq 1044 aa AA seqDB search
QNAMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHTYIQKLKGYLDPAVTRKKFRR
RVQESTQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTFDFESVESTV
ESSVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLKNSRLVSKK
DDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRG
GHEIILSAFDNFKEVCGEKQRFEKLMEHFRNEDNNIDFMVASMQFINIVVHSVEDMNFRV
HLQYEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEEL
EENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEK
EEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSTGSEVVAGNSVGPTT
GAASSGPLPPPPPPLPPSSDTPESVENGPVTPPMPPPPPPPPPPPPPPTPPPPLPGPVAE
TVPAPPLAPPLPSAPPLPGTSSPTVVFNSGLAAVKIKKPIKTKFRMPVFNWVALKPNQIN
GTVFNEIDDERILEDLNVDEFEEIFKTKAQGPAIDLSSSKQKISQKGTNKVTLLEANRAK
NLAITLRKAGKTAEEICKAIHVFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERKPLE
NLSDEDRFMMQFSKIERLMQKMTIMAFIGNFAESIQMLTPQLHAIIAASVSIKSSQKLKK
ILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYHQVSL
FYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMHDHNMLLKEFILNNEGKLKKL
QDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALME
KLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKK
NNITKFPNVHSRILETNPTDEPMR
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
cagaatgctatgaacctacctcctgacaaagccaggttactgcggcagtatgacaatgag
aaaaaatgggaactgatttgtgatcaggaacgattccaggtgaagaatcctccccataca
tacattcaaaagctcaaaggctatctggatccagctgtaaccaggaagaaattcagacgg
cgtgttcaggaatctacacaagtgctaagagaactggaaatttctttaagaactaatcac
attggatgggtcagagaatttctgaatgaagaaaacaaaggtctcgatgttctagtggaa
tatctctcatttgcacagtacgcagtaacttttgactttgaaagtgtggagagtactgtg
gagagctcggtggacaaatcaaagccctggagcaggtccatcgaggacctgcacagaggg
agcaacctgccctcacctgtgggcaacagtgtctcccgctctggaagacattctgcgctg
cgatacaatactttgccaagcagaagaactctgaaaaattcaagattagtgagtaagaaa
gatgacgtacatgtctgtatcatgtgtttacgtgccatcatgaattatcagtatggtttc
aacatggtcatgtctcatccacatgctgtcaatgaaattgcactaagcttgaacaacaag
aatcccagaacaaaagcccttgtcttagaactgttggctgctgtttgtcttgtcagaggc
ggacatgaaatcattttatcagcatttgataactttaaagaggtttgcggagaaaaacag
cgctttgagaagttgatggaacatttcaggaatgaggacaataacatagattttatggtg
gcttctatgcagtttattaatattgtagttcattcagtagaagatatgaatttcagagtt
cacctccaatatgaatttaccaaattaggcctggatgaatacttggacaagctgaaacac
actgagagtgacaagcttcaggtccagatccaggcttacctggacaacgtttttgatgta
ggagctctgctggaagacgctgaaactaagaatgccgccttggagcgggtggaagaactg
gaagaaaacatctctcatttatctgaaaaactgcaagacacagagaatgaagccatgtcc
aagattgtggaactggaaaagcaactcatgcagaggaacaaggagctggatgttgttcgg
gaaatctacaaagatgcaaatacccaagttcacactttaagaaaaatggtcaaagaaaaa
gaagaagcaattcaaagacagtctaccctggaaaaaaagattcatgaactggagaaacaa
gggaccattaaaattcagaagaaaggggatggggatattgccatactgccagttgtggct
tctggcacattgtccacagggtcagaagtggtagcaggtaactctgtgggacccacaaca
ggggccgcttcctcgggacccctgccccctcctccaccaccactgcctccctcttcagac
acacctgaatcagtggaaaatggtccggtaacaccacctatgccgccaccgccaccgcca
ccgcctcctccccctcctcctccaacacctcctcctcctctcccaggtcctgtagctgag
actgtaccagctcctcccttagcacctccccttccctctgcacccccgctgcctggaaca
tcttcacccacagtggttttcaactcaggattagcagctgtgaaaattaagaagccaatc
aagacgaagttcagaatgccggtgtttaactgggttgctttgaagcccaatcagatcaat
gggacagtcttcaatgaaattgatgatgagcgaattctggaggatttaaatgtggatgaa
tttgaggaaatattcaagacaaaagcccaaggtcctgccattgatctttcttcaagcaaa
cagaagatatcacagaagggaacaaacaaagtgacattactagaagcaaacagggccaaa
aatctggccataactttaaggaaagctggaaagactgccgaggagatatgtaaagctatt
catgtatttgacttgaagacactgcctgtagactttgtggaatgcttgatgcggttcttg
ccaactgagaatgaagtgaaagtgcttcggctttatgagcgggaaaggaagcctttggaa
aacttgtcagatgaagatcggttcatgatgcagtttagtaaaatcgagaggctcatgcag
aagatgaccatcatggccttcattgggaactttgctgaaagcattcagatgctgactcct
caactacatgcgatcatagcagcatctgtctctataaagtcgtcccaaaaactcaagaaa
attctggagatcatcttagcccttggaaactacatgaatagcagtaaaagaggagcagtt
tatggattcaaacttcagagtttagatctgctcttagatacaaagtcaacagacaggaag
caaacgctgttgcactatatatccaatgtggtgaaagaaaaatatcaccaagtgtccctg
ttttataatgagcttcattatgtggaaaaagctgctgcagtctcccttgagaatgttttg
ctggatgtcaaggagctccagaggggaatggacttgaccaagagagagtacaccatgcat
gaccacaacatgctgctgaaggagttcatcctcaacaatgaggggaagctgaagaagctg
caggatgatgccaagattgcacaggatgcctttgatgatgttgtgaagtattttggagaa
aaccccaagacaacaccaccctctgtcttctttcctgtctttgtccggtttgtgaaagcg
tataagcaagcagaagaggaaaacgagctgaggaaaaagcaggaacaagctctcatggaa
aaactcctggagcaagaagctctgatggagcagcaggatccaaagtctccttctcataaa
tcaaaaaggcagcagcaagagttaattgcagaattaagaagacgacaagttaaagataac
agacatgtatatgagggaaaagatggtgccattgaagatatcatcacagctttaaagaag
aataatatcactaaatttccaaatgttcactcgaggatcttagaaaccaaccctacagac
gagccgatgcggtga

DBGET integrated database retrieval system