KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413091Help
Entry
100413091         CDS       T03264                                 

Gene name
ARTN
Definition
(RefSeq) artemin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta
Motif
Other DBs
NCBI-GeneID: 100413091
NCBI-ProteinID: XP_017830125
Ensembl: ENSCJAG00000003859
UniProt: F6PVA3
LinkDB All DBs
Position
7
AA seq 228 aa AA seqDB search
MELGLGGLSALSHCPWPRWQAPLGLSAQPALWPTLAALALLSSVAEASLGPAPRSPAPRE
GPAPVLAPLAGHLPGGRTTRCCRGRARRPPPQPSRPAPPPPAPPSAPPRGGRAARAGGRG
SRAPAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAG
ALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggaacttggacttggaggcctctctgcactgtcccactgcccctggcctaggtggcag
gctccacttggtctctccgcgcagcctgccctgtggccaaccctggccgctctggctctg
ctgagcagcgtcgcagaggcctccctgggccccgcgccccgcagccccgccccccgcgaa
ggccccgcgccggtcctggcgcccctcgccggccacctgccggggggacgcacgacccga
tgctgcaggggaagagcccggcggccgccgccgcagccttctcggccagcgcctccgccg
cccgcgccaccctctgctcctccccgcgggggccgcgcggctcgggctgggggtcggggc
agccgcgcaccggccgcgggggcgcgtggctgccgcctgcgctcgcagctggtgccggtg
cgcgcgctcggcctgggccaccgctccgacgagctggtgcgtttccgcttctgcagcggc
tcctgccgccgcgcgcgctctccgcacgacctcagcctggccagcctcctgggcgccggg
gccctgcgaccgcccccgggctcccggcctgtcagccagccttgctgccgacccacgcgc
tacgaagcggtctccttcatggacgtcaacagcacctggagaactgtggaccgcctctcg
gccaccgcctgcggttgcctgggctga

DBGET integrated database retrieval system