KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413151
Entry
100413151         CDS       T03264                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response 88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05135  Yersinia infection
cjc05140  Leishmaniasis
cjc05142  Chagas disease
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100413151 (MYD88)
   04064 NF-kappa B signaling pathway
    100413151 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100413151 (MYD88)
   04621 NOD-like receptor signaling pathway
    100413151 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100413151 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100413151 (MYD88)
   05135 Yersinia infection
    100413151 (MYD88)
   05133 Pertussis
    100413151 (MYD88)
   05134 Legionellosis
    100413151 (MYD88)
   05152 Tuberculosis
    100413151 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100413151 (MYD88)
   05161 Hepatitis B
    100413151 (MYD88)
   05171 Coronavirus disease - COVID-19
    100413151 (MYD88)
   05164 Influenza A
    100413151 (MYD88)
   05162 Measles
    100413151 (MYD88)
   05168 Herpes simplex virus 1 infection
    100413151 (MYD88)
   05169 Epstein-Barr virus infection
    100413151 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    100413151 (MYD88)
   05145 Toxoplasmosis
    100413151 (MYD88)
   05140 Leishmaniasis
    100413151 (MYD88)
   05142 Chagas disease
    100413151 (MYD88)
   05143 African trypanosomiasis
    100413151 (MYD88)
SSDB
Motif
Pfam: TIR Death TIR_2
Other DBs
NCBI-GeneID: 100413151
NCBI-ProteinID: XP_002759780
Ensembl: ENSCJAG00000010193
LinkDB
Position
17
AA seq 296 aa
MAAEGPGAGSVTPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTVLAEEMDFEYLE
IRQLESHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ
QQEEAEKPLQVASVDSSVPRTTELAGITTLDDPLGQMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMNKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt   +upstreamnt  +downstreamnt
atggctgcagaaggtcccggcgcggggtctgtgaccccggtatcctccacatcctccctg
cccctggctgctctcaacatgcgagtgcggcgccgcctgtcgctgttcttgaacgtgcgg
acgcaggtggcagccgactggaccgtgctggcggaggaaatggactttgagtacttggag
atccggcagctggaatcgcacgccgaccccacgggcaggctgctggacgcctggcaggga
cgccccggtgcctcggtaggccgactgctggagctgctcaccaagctgggccgcgacgac
gtgctgctggagctgggacccagcattgaggaggattgccaaaagtatatcttgaagcag
cagcaggaggaggctgagaagccgttacaggtggcctctgttgacagcagtgtcccacgg
acaacagagctggcgggcatcaccacacttgacgaccccctggggcaaatgcctgagcgt
ttcgatgccttcatctgctattgccccagcgacatccagtttgtgcaggagatgatccgg
caactggaacagacaaactatcgactgaagttatgtgtgtctgaccgcgatgtcctgcct
ggcacctgtgtctggtctattgctagtgagctcatcgagaagaggtgccgccggatggtg
gtggttgtctctgatgattacctgcagagcaaggaatgtgacttccagaccaaatttgca
ctcagcctctctccaggtgcccatcagaagcgactgatccccatcaagtacaaggcaatg
aacaaagagttccccagcatcctgaggttcatcaccgtctgcgactacaccaatccctgc
accaaatcttggttctggactcgccttgccaaggccctgtccctgccctga

DBGET integrated database retrieval system