KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413178
Entry
100413178         CDS       T03264                                 

Gene name
SNAP25
Definition
(RefSeq) synaptosome associated protein 25
  KO
K18211  synaptosomal-associated protein 25
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04721  Synaptic vesicle cycle
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100413178 (SNAP25)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100413178 (SNAP25)
Membrane trafficking [BR:cjc04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-25
    100413178 (SNAP25)
SSDB
Motif
Pfam: SNAP-25 DUF5089 Spc7 Sec20 V-SNARE_C DUF349
Other DBs
NCBI-GeneID: 100413178
NCBI-ProteinID: XP_002747405
Ensembl: ENSCJAG00000021350
UniProt: F7GP26
LinkDB
Position
5
AA seq 206 aa
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERI
EEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG
NT seq 621 nt   +upstreamnt  +downstreamnt
atggccgaagacgcagatatgcgcaatgagctggaggagatgcagagaagggctgaccag
ttggctgatgagtcgctggaaagcacccgtcgtatgctgcaactggttgaagagagtaaa
gatgctggtatcaggactttggttatgttggatgaacaaggagaacaactggaacgcatt
gaggaagggatggaccaaatcaataaggacatgaaagaagcagaaaagaatttgacggac
ctaggaaaattctgcgggctttgtgtgtgtccctgtaacaagcttaaatcaagtgatgct
tacaaaaaagcctggggcaataatcaggatggagtggtggccagccagcctgctcgtgta
gtggacgaacgggagcagatggccatcagtggcggcttcatccgcagggtaacaaatgat
gcccgagaaaatgaaatggatgaaaacctggagcaggtgagcggtatcatcgggaacctc
cgtcacatggccctggatatgggcaatgagatcgatacacagaatcgccagatcgacagg
atcatggagaaggctgattccaacaaaaccagaattgatgaggccaaccaacgtgcaaca
aagatgctgggaagtggttaa

DBGET integrated database retrieval system