KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413256
Entry
100413256         CDS       T03264                                 

Gene name
BCL6
Definition
(RefSeq) B-cell CLL/lymphoma 6
  KO
K15618  B-cell lymphoma 6 protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100413256 (BCL6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100413256 (BCL6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100413256 (BCL6)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    100413256 (BCL6)
SSDB
Motif
Pfam: BTB zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-met zf-C2H2_jaz DZR zf-C2HE zf-C2H2_6 DUF3342 Zn-ribbon_8
Other DBs
NCBI-GeneID: 100413256
NCBI-ProteinID: XP_002758219
Ensembl: ENSCJAG00000014375
UniProt: F7IT93
LinkDB
Position
15
AA seq 706 aa
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVPAIKPPREEFLNSRMLMPQDIMAYRGREVVENSLPLRSAPGCESRAF
APSLYSGLSTQPASYSMYSPLPVSSFLFSDEELRDVRMPVANSFPKERALPCDSARPVPG
EYSRPALEVSPGMCHGNIYSPKETVPEEARSDMHYGVAEGPKPAAPSARNAPYFPCDKAS
KEEERPSSEDEIALRFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
ENLDLQSPTKLSANGEDSTIPQASRLNNIVNRSLTGSPRSSSESHSPLYMHPPKCASCGS
QSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggcctcgccggctgacagctgtatccagttcacccgccatgccagtgacgttcttctc
aacctgaatcgtctccggagtcgagacatcttgactgatgttgtcattgttgtgagccgt
gagcagtttagagcccataaaacagtcctcatggcctgcagtggcctgttctacagcatc
ttcacagaccagttgaaatgcaaccttagtgtgatcaatttagaccctgagatcaacccc
gaggggttctgcatcctcctggactttatgtacacgtctcgactcaatttgcgggagggc
aacatcatggctgtaatggccacagctatgtacctgcagatggagcatgttgtggatact
tgccggaagttcatcaaggccagtgaagcagagatggttcctgccatcaagcctccccgt
gaagagttcctcaacagccggatgctgatgccccaagacattatggcctatcggggtcgt
gaggtggtggagaacagcctgccgctgaggagtgcccctgggtgtgagagcagagccttt
gcccccagcctgtacagtggcctgtccacacagccagcctcttactctatgtatagcccc
ctccctgtcagcagcttcctcttctctgatgaggagcttcgagatgtccgcatgcctgtg
gccaactccttccccaaggagcgggccctcccatgcgacagtgccaggccagtccctggt
gagtacagccggccagccttggaggtgtcccctggcatgtgccacggcaatatctattcg
cccaaggaaacagtcccagaagaggcacgaagtgatatgcactacggtgtggctgagggg
cccaagcctgctgccccctcagcccggaacgccccctacttcccctgtgacaaggccagc
aaagaagaagagagaccctcctcagaagatgagattgccctgcgttttgagccccccaat
gcgcccctgaaccggaagggtctggtgagtcctcagagcccccagaaatctgactgccag
cccaactcgcctacagagtcctgcagcagtaagaatgcctgcatcctccaggcctctggc
tcccctccagccaagagccccactgaccccaaagcctgcaactggaagaaatacaagttc
atcgtgctcaacagcctcaaccagaatgccaaaccagaggggccagagcaggctgagctg
ggccgcctttccccacgagcctacactgccccgcctgcctgccagccacccatggagcct
gagaaccttgacctccagtccccaaccaagctcagtgccaacggggaggattccaccatc
ccacaagccagccggctcaataacatcgttaacaggtccctgacaggctctccccgcagc
agcagtgagagccactcaccgctctatatgcacccaccgaagtgcgcgtcctgtggctct
cagtccccacagcatgcggagatgtgcctgcacaccgccggacccacgtttcccgaggag
atgggagagacccagtctgagtactcagattccagctgtgagaacggggccttcttctgc
aatgagtgtgactgccgcttctctgaggaggcctcactcaagaggcacacgctgcagacc
cacagtgacaaaccctacaagtgtgaccgctgccaggcctccttccgctacaagggcaac
ctcgccagccacaagaccgtccacaccggtgagaaaccctatcgttgcaacatctgtggg
gcccagttcaaccggccagccaacctgaaaacccacactcgaattcactctggagagaag
ccctacaaatgcgaaacctgtggagccagatttgtacaggtggcccacctccgtgcccat
gtgctcatccacactggcgagaaaccctatccctgtgaaatctgtggcacccgcttccgg
caccttcagactctgaagagccacctgcgaatccacacaggagagaaaccttaccattgt
gagaagtgtaacctgcatttccgtcacaaaagccagctgcgacttcacttgcgccagaag
catggcgccatcaccaacaccaaggtgcaataccgcgtgtcggccacagacctgcctccg
gagctccccaaagcctgctga

DBGET integrated database retrieval system