KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413501Help
Entry
100413501         CDS       T03264                                 

Gene name
RIBC2
Definition
(RefSeq) RIB43A domain with coiled-coils 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 100413501
NCBI-ProteinID: XP_002743895
Ensembl: ENSCJAG00000022546
LinkDB All DBs
Position
1
AA seq 323 aa AA seqDB search
MAVALPRDLQQDASLAKRRHAELCRQKRIFNARNRIIGGDTEAWDVQVHDQKIKEATEKA
RHETFAAEMRQNDKIMCILENRKKRDRKNLCRAISDFQRSFQKPETRREFDLSDPLALKN
DLPARQSDHDVRNTISGMQKFMGEDLNFHERKKFQEEQNREWSLQQQREWKNAQAERKHA
EAFYTETRLQFDETAKHLQKLESATRKAVCASVKEFNKSQAIESAERKKQEKAQELEDNL
AEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMHPGAAGADPLGSEAASPGEAEAPG
GRAPARPGLGPSADSGGSSHPAV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcgctgcccagggacttgcagcaggacgccagcctggccaagaggaggcac
gcggagctgtgcaggcagaagcggatcttcaacgccaggaacaggattattgggggagac
accgaagcctgggatgttcaagttcatgaccagaagataaaagaagctactgaaaaagct
agacatgaaacctttgctgctgaaatgaggcaaaatgacaaaataatgtgcatattggaa
aaccggaaaaagagggatcggaaaaatctctgtagggctatcagtgacttccaacggagc
tttcagaagccagaaactcgccgtgaatttgatctgtctgaccctctagcccttaagaac
gatcttccagcccggcagtcagatcatgatgttcggaatacgatatcaggaatgcagaaa
ttcatgggagaggatttaaacttccatgagaggaagaaattccaagaagaacaaaacagg
gaatggtccttgcagcagcagagggaatggaagaatgcccaggctgaacggaaacacgca
gaggccttctacacggagaccaggctgcagtttgatgagacagccaagcacctacagaag
ctggaaagcgccacccgaaaggcggtttgtgcatctgtgaaagagttcaacaagagccag
gccattgagtcagcagaaaggaaaaagcaagagaaagcgcaagaactagaggacaacttg
gccgagatcaccaacttgctgcgtggggacctgctctctgagaacccgcagcaggcagcc
agctccttcgggccccaccgcgtggtccccgaccgctggaagggcatgcaccctggagca
gctggagcagatccgcttggttcagaagcagcaagtccaggagaagctgaggctccagga
ggaagagcgccagcgagacctggactgggaccgtcggcggattcagggggctcgagccac
cctgctgtttga

DBGET integrated database retrieval system