KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414004Help
Entry
100414004         CDS       T03264                                 

Gene name
RXRB
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03320  PPAR signaling pathway
cjc04659  Th17 cell differentiation
cjc04919  Thyroid hormone signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05216  Thyroid cancer
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100414004 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100414004 (RXRB)
   03320 PPAR signaling pathway
    100414004 (RXRB)
   04919 Thyroid hormone signaling pathway
    100414004 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    100414004 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414004 (RXRB)
   05202 Transcriptional misregulation in cancer
    100414004 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100414004 (RXRB)
   05216 Thyroid cancer
    100414004 (RXRB)
   05222 Small cell lung cancer
    100414004 (RXRB)
   05223 Non-small cell lung cancer
    100414004 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100414004 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cjc03310]
    100414004 (RXRB)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100414004 (RXRB)
Nuclear receptors [BR:cjc03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100414004 (RXRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Motif
Other DBs
NCBI-GeneID: 100414004
NCBI-ProteinID: XP_002746468
Ensembl: ENSCJAG00000021619
LinkDB All DBs
Position
4
AA seq 532 aa AA seqDB search
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAGGKQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKP
PVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC
RDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPV
DRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFS
SLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVL
TELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPE
QQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggccgctcgcccgcccttcctccctcagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcagcggcggcggcggcggcggcaggcggaaaacaacaaaccccg
gaaccggagccgggggaggccggacgggacgggatgggcgacagcgggcgggactcccga
agcccagacagctcctccccaaatccccttccccagggagtccctcccccttctcctcct
gggccacccctacccccttcaacagctccatcccttggaggctctggggccccaccccca
cccccgatgccaccacccccactgggctctccctttccagttatcagttcttccatgggg
tcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagcccccag
attaactcaacagtgtcgctccctgggggtgggtctggcccccctgaagatgtgaagcca
ccagtcttaggggtccggggcctgcactgtccaccccctccaggtggcccgggggctggc
aaacggctatgtgcaatctgcggggacagaagctcaggcaaacactacggggtttacagc
tgtgagggttgcaagggcttcttcaaacgcaccatccgaaaggaccttacgtactcttgc
cgggacaacaaagactgcacagtagacaagcgccagcggaaccgctgtcagtactgccgc
taccagaagtgcctggccactggcatgaagagggaggcggtacaggaggagcgtcagcgg
ggaaaggacaaggatggggatggggagggggctgggggagcccctgaggagatgcctgtg
gacaggatcctggaggcagagcttgctgtggagcagaagagtgaccagggcgttgagggt
cctgggggaaccggtggtagcggcagcagcccaaatgaccccgtgactaacatctgtcag
gcagctgacaaacagctattcacgcttgttgagtgggcgaagaggatcccacacttttcc
tccttgcctctggatgatcaggtcatattgctgcgggcaggctggaacgaactcctcatt
gcttccttctcccaccgatccattgatgttcgagatggcatcctccttgccacaggtctt
catgtgcaccgaaactcagcccattcagcaggagtaggagccatctttgatcgggtgctg
acagagctagtgtccaaaatgcgtgacatgaggatggacaagacagagcttggctgcctg
agggcaatcattctgtttaatccagatgccaagggcctctccaaccctagtgaggtggag
gtcctgcgggagaaagtgtatgcatcactggagacctactgcaaacagaagtaccctgag
cagcagggacggtttgccaagctgctgctacgtcttcctgccctccggtccatcggcctt
aagtgtctagagcatctgtttttcttcaagctcattggtgacacccccatcgacactttt
cttatggagatgcttgaggctccccatcaactggcctga

DBGET integrated database retrieval system