KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414435Help
Entry
100414435         CDS       T03264                                 

Gene name
CHRNA10
Definition
(RefSeq) cholinergic receptor nicotinic alpha 10 subunit
  KO
K04811  nicotinic acetylcholine receptor alpha-10
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100414435 (CHRNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100414435 (CHRNA10)
Ion channels [BR:cjc04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   100414435 (CHRNA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 100414435
NCBI-ProteinID: XP_002754889
Ensembl: ENSCJAG00000015465
LinkDB All DBs
Position
11
AA seq 450 aa AA seqDB search
MGLRSHHLSLGLLLLFLLPPECLGAEGRLALKLFRDLFTNYTSALRPVADTDQTLNVTLE
VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYN
KADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQRCGLTFGSWTHGGH
QLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
CNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMPPAESVPLIGK
YYMATMTMVTFSTALTILIMNLHYCGPSARPVPAWARALLLGHLARGLCVRERGQPCGQS
RPPESSPIPEPPEGGAGHPEGPCHEPRCLCHQEALLRHVATIANTFHSHRAAQRCHEDWK
RLARVMDRFFLGIFFSMALVMSLLVLVQAL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggggctccggagccaccacctcagcctgggccttctgttgctgtttctactccctcca
gagtgcctgggagctgagggccggctggctctcaagctgttccgtgacctcttcaccaat
tacacaagtgccttgagacctgtggcagacacagaccagactctgaatgtgaccctggag
gtgacactgtcccagatcatcgacatggatgaacggaaccaggtactgactctgtacctg
tggatacggcaggagtggacagatgcctaccttcgatgggaccccaatgcctatggtggc
ctggatgccatccgcatccccagcagtcttgtgtggaggccagacatcgtactctataac
aaggcggatgcgcagccgccaggctccgccagcaccaacgtggttctgcgccacgacggc
gccgtgcgctgggacgcgccggccatcacgcgcagctcgtgccgcgtggacgtggcggcc
ttcccgttcgacgcccagcgctgcggcctgacgttcggctcctggacccacggcgggcac
cagttggatgtgcggccgcgcggcgccgccgccagcctggcggacttcgtggagaacgtg
gagtggcgcgtgctaggcatgccggcgcgacggcgcgtgctcacctacggctgctgctcc
gagccctaccctgacgtcaccttcacgctgctgctgcgccgccgcgccgccgcctatgtg
tgcaacctgctgctgccctgcgtgctcatctcgctgctcgcgccgctcgccttccacctg
cccgccgactctggcgagaaggtgtctctgggcgtcaccgtgctgctggcgctgaccgtc
ttccagctgctgctggccgagagcatgccgccggccgagagtgtgccgctcattgggaag
tactacatggctactatgaccatggtcacattctcgacagcactcaccatccttatcatg
aacctgcattattgtggtcccagtgcccgcccagtgccagcctgggctagggccctcctg
ctgggacacctggcacggggcctgtgtgtgcgggaaagaggacagccctgtgggcagtcc
aggccacctgagtcatcccctatccctgagcctcctgagggaggggctggccacccagag
ggcccttgccatgagccacggtgtctgtgccaccaggaagccctgctgcgccatgtagcc
accattgccaataccttccacagccaccgagctgcccagcgctgccatgaggactggaag
cgccttgcccgtgtgatggaccgcttcttcctgggcatcttcttctccatggccctggtc
atgagcctcctggtgctggtgcaggccctgtga

DBGET integrated database retrieval system