KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414496Help
Entry
100414496         CDS       T03264                                 

Gene name
PPP5C
Definition
(RefSeq) protein phosphatase 5 catalytic subunit
  KO
K04460  serine/threonine-protein phosphatase 5 [EC:3.1.3.16]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100414496 (PPP5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100414496 (PPP5C)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100414496 (PPP5C)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    Catalytic subunits
     100414496 (PPP5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos PPP5 TPR_1 TPR_2 TPR_11 TPR_16 TPR_8 TPR_9 TPR_19 TPR_14 TPR_17 TPR_12 TPR_7 bPH_4 USP8_dimer MIT ANAPC3
Motif
Other DBs
NCBI-GeneID: 100414496
NCBI-ProteinID: XP_002762302
Ensembl: ENSCJAG00000011891
UniProt: F7AU33
LinkDB All DBs
Position
22
AA seq 499 aa AA seqDB search
MAMAEGERTECAEPPRDEPPTDGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPS
NAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYE
TVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPK
LEDGKVTITFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVC
GDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLL
RGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDG
VTLEDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTKAFLEENNL
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVP
HPNVKPMAYANTLLQLGMM
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcggagggcgagcggactgagtgtgctgagcccccccgggacgaacccccg
actgatggcgctctgaagcgggcagaggagctcaagacgcaggccaatgactacttcaaa
gccaaggactacgagaacgccatcaagttctacagccaggccatcgagctgaaccccagc
aatgccatctactatggcaaccgcagcctggcctacctgcgcaccgagtgctacggctac
gcactgggagacgccacgcgggccatcgagctggacaagaagtacatcaagggttattac
cgtcgggctgccagcaacatggcgctgggcaagttccgggccgcgctgcgagactacgag
acggtggtcaaggtgaagccccatgacaaggacgccaaaatgaaataccaggagtgcaac
aagatcgtgaagcagaaggcctttgagcgggccatcgcgggcgacgagcacaagcgctct
gtggtggactccctggacattgagagcatgaccatcgaggatgagtacagcggacccaag
ctggaggacggcaaagtgacaatcaccttcatgaaggagctcatgcagtggtacaaggac
cagaagaaactgcaccggaaatgcgcctaccagattctggtacaggtcaaagaggtcctc
tccaagctgagcacactcgtggaaaccacactcaaagagacagagaagattacagtgtgc
ggggacacccatggccagttctatgacctcctcaacatattcgagctcaacggtttaccc
tcagagactaacccctatatatttaatggtgactttgtggaccgaggctccttctctgta
gaagtgatcctcacccttttcggctttaagctcctgtacccagatcactttcatcttctt
cgaggcaaccatgagacagacaacatgaaccagatctatggtttcgagggtgaggtgaag
gccaagtacacagcccagatgtacgagctcttcagcgaggtgttcgagtggctcccactg
gcccagtgcatcaacggcaaagtgctgatcatgcacggaggcctcttcagtgaagacggc
gtcaccctggaggacatccggaaaatcgagcgaaatcggcaaccccccgattcaggtccc
atgtgtgacctgctctggtcggatccgcagccacagaatgggcgctcagtcagcaagcgg
ggcgtgagctgtcagtttgggcccgacgtcaccaaggccttcttggaagagaacaacctg
gactacatcatccgcagccatgaggtcaaggcagagggctacgaggtggctcacggaggc
cgctgtgtcactgtcttctctgcccccaactactgcgaccagatggggaacaaagcctcc
tacatccacctccagggctccgacctacggcctcagttccaccagttcacagcagtgcct
catcccaacgtcaagcccatggcctacgccaacacgctgctgcagctgggaatgatgtga

DBGET integrated database retrieval system