KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414864
Entry
100414864         CDS       T03264                                 

Gene name
NLK
Definition
(RefSeq) nemo like kinase
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04068  FoxO signaling pathway
cjc04310  Wnt signaling pathway
cjc04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100414864 (NLK)
   04310 Wnt signaling pathway
    100414864 (NLK)
   04068 FoxO signaling pathway
    100414864 (NLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100414864 (NLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100414864 (NLK)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100414864 (NLK)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100414864 (NLK)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 100414864
NCBI-ProteinID: XP_002748311
Ensembl: ENSCJAG00000012490
LinkDB
Position
5
AA seq 527 aa
MSLCGAITHPKMMAAYNGGTSAASAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQKHTSSAAAAAAASAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgtctctttgtggcgcaataacccaccccaaaatgatggcggcttacaatggcggtaca
tctgcagcatcagcaggtcaccaccaccaccatcaccaccaccttccacacctcccacct
cctcacctgcaccaccaccaccaccctcaacaccatcttcatccggggtcagctgccgct
gtacaccctgtacagaagcacacctcttcggcagctgcggcagccgcagcatcagctgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcaccggcaccgggg
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgctaca
gttaaggcgcatcatcatcagcactcgcatcatccacaacaacagctggatattgaaccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcgctcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaagcatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgacctacataaaattatcgtctctcctcaacctctcagctcagatcat
gtcaaagtttttctttatcaaattttgcgaggtttgaaatatctccattcagctggcatt
ttacatcgagacattaagccagggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaagaattagatgaatcccgtcatatgactcaggaa
gttgttactcagtattatcgggctccggaaatcctgatgggcagccgtcattacagcaat
gctattgacatctggtctgtcggatgtatctttgcagaactactaggacgaagaatattg
tttcaggcacagagtcccattcagcagttggatttgatcaccgatctgttgggcacacca
tcactggaagcaatgaggacagcttgtgaaggcgctaaggcacatatactcaggggtcct
cataaacagccatctcttcctgtactctataccctgtctagccaggctacacatgaagct
gttcatctcctttgcaggatgttggtctttgatccatccaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcgactacgatatcacacatgtatgtgtaaa
tgttgcttttccacctctactggaagagtttataccagtgactttgagcctgtcaccaat
cccaaatttgatgacacttttgagaagaacctcagttctgtccgacaggttaaagaaatt
attcaccagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccct
cagtctgctgcttttaagagctttattagttccactgttgctcagccatctgagatgccc
ccatctcctctggtgtgggagtga

DBGET integrated database retrieval system