KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415082Help
Entry
100415082         CDS       T03264                                 

Gene name
PNPLA1
Definition
(RefSeq) patatin like phospholipase domain containing 1
  KO
K16813  patatin-like phospholipase domain-containing protein 1 [EC:3.1.1.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100415082 (PNPLA1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     100415082 (PNPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Patatin
Motif
Other DBs
NCBI-GeneID: 100415082
NCBI-ProteinID: XP_017826531
LinkDB All DBs
Position
4
AA seq 463 aa AA seqDB search
MSDFTRFTDGESVVVSEFTSKEELIEALYCSCFVPVYCGLIPPTYRGVRYIDGGFTGMQP
CAFWTDSITISTFSGQQDICPRDCPAIFHDFRMFNCSFQFSLENIARMTHALFPPDLVIL
HDYYYRGYDDAVLYLRRLNAVYLNSPSKRVIFPRVEVYCQIELALGNECPEHSRPSLQAR
RASLEGATQPHTEWAPKREARGSHGPPVSSPVQTPESTYEPPVSPPVSPLEQPPAQPLAS
SMPLSPSGTPPVSFPAAYKSPSSTSGSSLPTTPPGQSPASPQQQVQPSGSPPRSPHSQAS
TSPRPSLGTSAARAPQTPPQGSLSASPAQPPVEELGPGKPQAVAPLDSANPKSTVPLVHV
KETISKPYVMESPAEDSNWVNKVFKKNKQKTSGTRKGFPRHPQSKKPSGKVHSAPCPFNF
PLLSTSETVWVTYRPHPSRIQECSCPEEAVSRERELETARERT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatttcacccgcttcacggatggggagagtgtggtggtttcagagttcacatcc
aaggaggagctcatcgaggccctgtactgcagctgcttcgtccctgtgtactgcggcctc
attcccccgacctaccgcggtgtgaggtacatcgatgggggcttcactggcatgcaaccc
tgtgccttctggaccgactccatcaccatctccaccttcagcgggcagcaggacatctgt
cctcgggactgccccgccatcttccacgacttccgaatgttcaactgctccttccagttc
tccctggaaaacatcgccaggatgacccacgcgttgttccccccggacctggtgatcctg
catgattactactatcgagggtacgacgatgcagtcttgtacttgaggcggctgaatgct
gtttatcttaattctccctctaagagagtgattttcccccgggtggaagtgtactgccag
atagaactcgcccttggcaatgagtgccctgaacacagtcgaccaagccttcaagcacgg
cgggccagtctggagggagccacacaacctcacacagagtgggctcccaaaagggaggca
aggggcagccatggtccgcctgtgtcctcacctgtgcagacacctgaatccacatatgaa
ccacctgtttcaccaccagtctctccacttgagcagccacctgcacagccactggcctct
tcaatgccactttctccaagtggcacaccacctgtatcattcccagctgcgtacaagtca
cccagctccacatccggctcatcactgcccaccacaccacctgggcagtcacctgcgtca
cctcagcagcaggtacaaccgtctggatcaccacccagatcccctcactctcaagcatcc
acttcacccaggccatcgctggggacttcagctgcgcgggcacctcaaacaccaccccaa
ggttctctttcagcctcccctgctcagccacctgtggaggaactaggcccaggaaagccc
caagctgtagctcctcttgactctgcaaatccaaaaagcactgtgcctctggttcatgtg
aaggaaaccatcagcaagccttatgtaatggagagccctgctgaagactcgaactgggtg
aataaggtcttcaagaagaacaagcaaaagacaagtggcaccagaaaaggcttcccaaga
catccgcaatccaaaaaaccaagcggcaaagtgcactctgctccctgcccattcaacttc
cctctgctctccacttctgagacagtttgggtcacctacagacctcatcccagccggatc
caggaatgcagctgccctgaggaagctgtgagccgagagagagaactggagacagcccgg
gagagaacctga

DBGET integrated database retrieval system