KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415094Help
Entry
100415094         CDS       T03264                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03030  DNA replication
cjc03410  Base excision repair
cjc03420  Nucleotide excision repair
cjc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100415094 (LIG1)
   03410 Base excision repair
    100415094 (LIG1)
   03420 Nucleotide excision repair
    100415094 (LIG1)
   03430 Mismatch repair
    100415094 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100415094 (LIG1)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100415094 (LIG1)
Enzymes [BR:cjc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100415094 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100415094 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100415094 (LIG1)
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100415094 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100415094 (LIG1)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100415094 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100415094 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     100415094 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR
Motif
Other DBs
NCBI-GeneID: 100415094
NCBI-ProteinID: XP_008986565
Ensembl: ENSCJAG00000000504
LinkDB All DBs
Position
22
AA seq 919 aa AA seqDB search
MQRSIMSFFHPKKEGKVKKPEKEASNSSRETEPPPKVALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEDLSPAKGQKPAPDCPQVSPPRPATSPESNPSLSDTSPMDSSPSGIPK
RRTARKQLPKRTIEEVLEEENADKDREAKRKKEEEEAETPKENLTEAEVATEKEREDGDQ
PTVPPKPLKTSEAETPMESISEPEVAMRQELQDEEEQAKPPRRAPKTLSNFFTPRKPAIK
KEVKEEEPGALGKEGAEGPLEPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIEE
VSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNQLGPPQQGLELGVGDGVLLKAVAQA
TGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFTKFRDIARLTGSASTA
KKIDIIKALFVACRHSEARYIARSLSGRLRLGLAEQSVLAALSQAMSLTPPGQEFPLAVV
DAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGLERLPEHCKLNPGIPLK
PMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHALESGEVKIFSRNQEDNTGKYPDI
ISRIPRIKLPSVTSFILDAEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFD
LIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEFLEQSVKDSCEG
LMVKTLDVDATYEIAKRSHNWLKMKKDYLSGVGDTLDLVVIGAYLGRGKRAGRYGGFLLA
CYDEDSEELQAICKLGTGFSDEELEAHHQSLQALVLPSPRPYVRIDDAVTPDHWLDPSAV
WEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQS
QIQNQQGEEDTGSDPEDTY
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccaccccaagaaagagggtaaagtgaagaaacct
gagaaggaggcatccaacagcagcagagagacggagccccctccgaaggtggcactgaag
gagtggaatggagtggtgtccgagagtgactctccagtgaagaggccagggaggaaggcg
gcccgggtcctgggcagtgaaggggaagaggaggatgaagaccttagccctgccaaaggc
cagaagcctgcccccgactgcccacaggtctcccctccccgccctgctacatctcctgag
agcaacccttccctctccgacacctctcccatggacagctccccctcagggatcccgaag
cgtcgcacagctcggaagcagctcccaaaacggaccattgaggaagtcctggaagaggag
aatgcagacaaggacagagaagccaagaggaagaaggaggaggaagaagcagagaccccg
aaagaaaatctcacagaggctgaagtagcaacagagaaggaaagagaagatggggaccag
cccactgtgcctcccaaacccctgaagacatctgaagcagagaccccgatggaaagcatt
tcagagcctgaggtggccatgagacaggagctgcaggacgaggaggagcaggccaagcct
ccccgcagagctcccaagacgctcagcaacttcttcaccccccggaagccagcaatcaaa
aaagaagtgaaagaagaggagccgggggctctgggaaaggagggagctgagggacccctg
gagccatccggttacaatcctgccaagaacaactaccatcccgtggaagacgcctgctgg
aaaccgggccagaaggtcccttacctggcggtggcccggacatttgagaagatcgaggag
gtgtctgctcggctgcggatggtggagacgctgagcaacttgctgcgctccgtggtggcc
ctgtcgcccccggacctcctccctgtcctctacctcagcctcaaccagcttgggccaccc
cagcagggcctggagcttggcgtgggtgatggcgtacttctcaaggcagtggcacaggcc
acaggtcggcagctggagtctgtccgggctgaggcagccgagaagggtgacgtggggctg
gtggccgagaatagccgcagcacccagaggctcatgctgccacctcctccgctcactgcc
tccggggtcttcaccaagttccgagacatcgccaggctcactggcagtgcttccacagcc
aagaagatagacatcatcaaagccctctttgttgcctgccgccactcagaagcccggtac
atcgccaggtccctgagcggacggctgcgccttgggctagcagagcagtcggtgctggcc
gccctctcccaggccatgagcctcacacccccaggccaagaattcccactggccgtggtg
gatgctggaaagggcaagacagcagaggcccgaaagacgtggctggaggagcaaggcatg
atcctgaagcagacgttctgtgaggtgcctgacctggaccgaattgtccccgtgctgctg
gagcatggcctggaacgtctgccggagcactgcaagctaaacccagggattcccctgaaa
ccaatgttggcccatcccacgcggggtgtcagtgaggtcctgaagcgctttgaggaggca
gctttcacctgcgagtacaaatatgacgggcagagggcacagatccacgctctggaaagc
ggggaggtgaagatcttcagcaggaatcaggaagacaacactgggaagtacccggacatc
atcagccgcatccccaggatcaaactcccatcggtcacatccttcatcctggacgccgaa
gctgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacccgc
aaacgcaaggaggtggatgcgtctgagatccaggtgcaggtgtgtttgtacgccttcgac
ctcatctacctcaacggagagtccctggtacgtgagcccctttcccgacgccggcagctg
ctccgggagaactttgtggagacagagggcgagttcgtcttcgccacctccctggacacc
aaggacgtcgagcagatcgccgagttcctggagcagtcggtgaaagactcctgcgagggg
ctaatggtgaagaccctggatgtcgatgccacctatgagattgccaagagatcgcacaac
tggcttaagatgaagaaggactacctcagtggcgtgggcgacactctggacctggtggtg
attggtgcctacctgggccgggggaagcgtgccggccgatacgggggcttcctgctcgcc
tgctacgatgaggacagtgaggagctacaggccatatgcaagcttggaactggcttcagc
gacgaggagctagaggcgcatcaccagagcctgcaggccctggtgctgcccagcccacgc
ccctacgtgcggatagatgacgctgtgactcccgaccactggctggaccccagcgccgtg
tgggaggtgaagtgcgctgacctctccctctcccccatctaccctgctgctcggggcctg
gtggatagtgacaagggcatctcccttcggttccctcggttcattcgagtccgtgaagac
aagcagccggagcaggcgaccaccagtgcccaggtggcctgtctgtaccggaagcaaagt
cagattcagaaccagcaaggcgaggaggacacaggctctgaccctgaagatacgtattaa

DBGET integrated database retrieval system