KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415140Help
Entry
100415140         CDS       T03264                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100415140 (MAPK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100415140 (MAPK6)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100415140 (MAPK6)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100415140 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 100415140
NCBI-ProteinID: XP_002753539
Ensembl: ENSCJAG00000000962
UniProt: F7FWM0
LinkDB All DBs
Position
10
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
TEPCWQYPDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSG
REDCFFINQFCEVRKDEQLEKENTYTSYLDKFFSRKEDTEMLEMEPTEDGKLGERGNEEG
FLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggttctaggtat
atggacttaaaaccgttgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttaccgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagacttgatcatgataacattgtgaaagtg
tttgaaattcttggtcccagtggaagccagttaacagacgatgtgggctctcttacggag
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctaatgtgctggag
cagggccctttactggaagagcatgccagacttttcatgtatcagctgctacgggggctc
aagtatattcactctgcaaatgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcacggatcatggatcct
cattattctcataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattacacgaaagccattgacatgtgggcagcaggctgc
atctttgctgaaatgctgactggtaaaaccctttttgcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattcctgttgtacatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacataagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtagagaagcactggatttcctggaacaaattttgacatttagc
cccatggatcggttaacagcagaagaagcgctctcccatccttacatgagcatatattct
tttccaatggatgagccaatttcaagccatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcacagtcacatttataactgggaaaggtaccatgattgt
cagttttcagagcatgattggcctatacataacaactttgatattgatgaagttcagctt
gatccaagagctctgtctgatgtcactgatgaagaggaagtacaggttgatccccgaaaa
tatttggatggagatcgggaaaagtatctggaagatcctgcttttgataccaattactct
actgagccttgttggcagtacccagatcatcatgaaaacaaatactgtgatctggagtgt
agccatacttgtaactacaaaacaaggtcatcatcatatttagataacttagtctggaga
gagagtgaagttaaccattactatgagcccaagcttattatagatctttccaattggaaa
gaacaaagcaaagaaaaatctgataagaaaggcaaatcaaaatgtgaaaggaatggattg
gttaaagcccagatagcactagaggaagcatcacagcaactggctggaaaagaaagggaa
aagaatcagggatttgattttgattcctttattgcaggaactattcagcttagttcccaa
catgagcctactgatgttgttgataaattaaatgacttgaatagctcagtgtcccaacta
gagttgaaaagtttgatatcaaagtcagtaagccaagaaaaacaggaaaaaggaatggca
aatttggctcaattagaagccttgtaccagtcttcttgggacagtcagtttgtgagtggt
cgggaggactgttttttcataaatcagttttgtgaggtaaggaaggatgaacaacttgag
aaggaaaacacttacactagttacctggacaagttctttagcaggaaagaagatactgaa
atgctagaaatggagcccacagaggatgggaagcttggggagagaggaaatgaggaagga
tttctgaacaacagtggggagttcctctttaacaagcagctcgagtccataggcatcccg
cagtttcacagtccagttgggtcaccactcaagtcaatacaggccaccttaacaccttct
gctatgaaatcttcccctcagattcctcacaaaacatacagcagcattctgaaacatctg
aactaa

DBGET integrated database retrieval system